KEGG   Mus musculus (mouse): 246228Help
Entry
246228            CDS       T01002                                 

Gene name
Vwa1, 4932416A11Rik, WARP
Definition
(RefSeq) von Willebrand factor A domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: VWA fn3 VWA_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 246228
NCBI-ProteinID: NP_680085
MGI: 2179729
Ensembl: ENSMUSG00000042116
Vega: OTTMUSG00000010849
UniProt: Q8R2Z5
Position
4; 4 E2
AA seq 415 aa AA seqDB search
MLFWTAFSMALSLRLALARSSIERGSTASDPQGDLLFLLDSSASVSHYEFSRVREFVGQL
VATMSFGPGALRASLVHVGSQPHTEFTFDQYSSGQAIQDAIRVAPQRMGDTNTGLALAYA
KEQLFAEEAGARPGVPKVLVWVTDGGSSDPVGPPMQELKDLGVTIFIVSTGRGNLLELLA
AASAPAEKHLHFVDVDDLPIIARELRGSITDAMQPQQLHASEVLSSGFRLSWPPLLTADS
GYYVLELVPSGKLATTRRQQLPGNATSWTWTDLDPDTDYEVSLLPESNVHLLRPQHVRVR
TLQEEAGPERIVISHARPRSLRVSWAPALGPDSALGYHVQLGPLQGGSLERVEVPAGQNS
TTVQGLTPCTTYLVTVTAAFRSGRQRALSAKACTASGARTRAPQSMRPEAGPREP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgctgttctggactgcgttcagcatggctttgagtctgcggttggcattggcgcggagc
agcatagagcgcggttccacagcatcagacccccagggggacctgttgttcctgttggac
agctcagccagcgtgtcacactatgagttctcaagagttcgggaatttgtggggcagctg
gtggctacgatgtctttcggacccggggctctgcgtgctagtctggtgcacgtgggcagc
cagcctcacacagagtttacttttgaccagtacagttcaggccaggctatacaggatgcc
atccgtgttgcaccccaacgtatgggtgataccaacacaggcctggcactggcttatgcc
aaagaacaattgtttgctgaggaagcaggtgcccggccaggggttcccaaggtgctggtg
tgggtgacagatggtggctccagcgaccccgtgggcccccctatgcaggagctcaaggac
ctgggtgtcaccatcttcattgtcagcactggccgaggcaacctgttggagctgttggca
gctgcctcggctcctgccgagaagcacctacactttgtggatgtggatgatcttcctatc
attgcccgggagctgcggggctccataactgatgcgatgcagccacaacagcttcatgcc
tcggaggttctgtccagtggcttccgcctgtcctggccgcccctgctgacagcggactct
ggttactacgtgctggaattggtacctagcggcaaactggcaaccacaagacgccaacag
ctgcccgggaatgctaccagctggacctggacagatctcgacccggacacagactatgaa
gtatcactgctgcctgagtccaacgtgcacctcctgaggccgcagcacgtgcgagtacgc
acactgcaagaggaggccgggccagaacgcatcgtcatctcgcatgcgaggccgcgcagc
ctccgcgtaagctgggcccccgcgcttggcccggactccgctctcggctaccatgtacag
ctcggacctctgcagggcgggtccctagagcgcgtggaggtgccagcaggccagaacagc
actaccgtccagggcctgacgccctgcaccacttacctggtgactgtgactgccgccttc
cgctccggccgccagagggcgctgtcggctaaggcctgtacggcctctggcgcgcggacc
cgtgctccgcagtccatgcggccggaggctggaccgcgggagccctga

DBGET integrated database retrieval system