KEGG   Mus musculus (mouse): 246228
Entry
246228            CDS       T01002                                 

Symbol
Vwa1, 4932416A11Rik, W, WARP
Name
(RefSeq) von Willebrand factor A domain containing 1
  KO
K24507  von Willebrand factor A domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    246228 (Vwa1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Von Willebrand domain-containing proteins
  VWA domain-containing proteins
   246228 (Vwa1)
SSDB
Motif
Pfam: VWA fn3 VWA_2 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 246228
NCBI-ProteinID: NP_680085
MGI: 2179729
Ensembl: ENSMUSG00000042116
Vega: OTTMUSG00000010849
UniProt: Q8R2Z5
Position
4; 4 E2
AA seq 415 aa
MLFWTAFSMALSLRLALARSSIERGSTASDPQGDLLFLLDSSASVSHYEFSRVREFVGQL
VATMSFGPGALRASLVHVGSQPHTEFTFDQYSSGQAIQDAIRVAPQRMGDTNTGLALAYA
KEQLFAEEAGARPGVPKVLVWVTDGGSSDPVGPPMQELKDLGVTIFIVSTGRGNLLELLA
AASAPAEKHLHFVDVDDLPIIARELRGSITDAMQPQQLHASEVLSSGFRLSWPPLLTADS
GYYVLELVPSGKLATTRRQQLPGNATSWTWTDLDPDTDYEVSLLPESNVHLLRPQHVRVR
TLQEEAGPERIVISHARPRSLRVSWAPALGPDSALGYHVQLGPLQGGSLERVEVPAGQNS
TTVQGLTPCTTYLVTVTAAFRSGRQRALSAKACTASGARTRAPQSMRPEAGPREP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgctgttctggactgcgttcagcatggctttgagtctgcggttggcattggcgcggagc
agcatagagcgcggttccacagcatcagacccccagggggacctgttgttcctgttggac
agctcagccagcgtgtcacactatgagttctcaagagttcgggaatttgtggggcagctg
gtggctacgatgtctttcggacccggggctctgcgtgctagtctggtgcacgtgggcagc
cagcctcacacagagtttacttttgaccagtacagttcaggccaggctatacaggatgcc
atccgtgttgcaccccaacgtatgggtgataccaacacaggcctggcactggcttatgcc
aaagaacaattgtttgctgaggaagcaggtgcccggccaggggttcccaaggtgctggtg
tgggtgacagatggtggctccagcgaccccgtgggcccccctatgcaggagctcaaggac
ctgggtgtcaccatcttcattgtcagcactggccgaggcaacctgttggagctgttggca
gctgcctcggctcctgccgagaagcacctacactttgtggatgtggatgatcttcctatc
attgcccgggagctgcggggctccataactgatgcgatgcagccacaacagcttcatgcc
tcggaggttctgtccagtggcttccgcctgtcctggccgcccctgctgacagcggactct
ggttactacgtgctggaattggtacctagcggcaaactggcaaccacaagacgccaacag
ctgcccgggaatgctaccagctggacctggacagatctcgacccggacacagactatgaa
gtatcactgctgcctgagtccaacgtgcacctcctgaggccgcagcacgtgcgagtacgc
acactgcaagaggaggccgggccagaacgcatcgtcatctcgcatgcgaggccgcgcagc
ctccgcgtaagctgggcccccgcgcttggcccggactccgctctcggctaccatgtacag
ctcggacctctgcagggcgggtccctagagcgcgtggaggtgccagcaggccagaacagc
actaccgtccagggcctgacgccctgcaccacttacctggtgactgtgactgccgccttc
cgctccggccgccagagggcgctgtcggctaaggcctgtacggcctctggcgcgcggacc
cgtgctccgcagtccatgcggccggaggctggaccgcgggagccctga

DBGET integrated database retrieval system