KEGG   Mus musculus (mouse): 246256Help
Entry
246256            CDS       T01002                                 

Gene name
Fcgr4, 4833442P21Rik, CD16-2, FcgRIV, FcgammaRIV, Fcgr3a, Fcrl3
Definition
(RefSeq) Fc receptor, IgG, low affinity IV
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    246256 (Fcgr4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    246256 (Fcgr4)
  09158 Development
   04380 Osteoclast differentiation
    246256 (Fcgr4)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    246256 (Fcgr4)
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    246256 (Fcgr4)
   05152 Tuberculosis
    246256 (Fcgr4)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    246256 (Fcgr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    246256 (Fcgr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    246256 (Fcgr4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    246256 (Fcgr4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    246256 (Fcgr4)
CD molecules [BR:mmu04090]
 Proteins
  246256 (Fcgr4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  246256 (Fcgr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C1-set
Motif
Other DBs
NCBI-GeneID: 246256
NCBI-ProteinID: NP_653142
MGI: 2179523
Ensembl: ENSMUSG00000059089
Vega: OTTMUSG00000022168
UniProt: A0A0B4J1G0
Position
1 H3; 1 78.53 cM
AA seq 249 aa AA seqDB search
MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWF
HNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEG
DPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNK
SSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKI
QWSKEPQDK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctactactaccaacagctctggtacttacagctttctctggcattcaagct
ggtctccaaaaggctgtggtgaacctagaccccaagtgggtcagggtgcttgaggaagac
agcgtgaccctcagatgccaaggcactttctcccccgaggacaattctatcaagtggttc
cataacgaaagcctcatcccacaccaggatgccaactatgtcatccaaagtgccagagtt
aaggacagtggaatgtacaggtgccagacagccctctccacgatcagtgacccagtgcaa
ctagaggtccatatgggctggctattgcttcagaccactaagtggctgttccaggagggg
gaccccattcatctgagatgccacagttggcaaaacagacctgtacggaaggtcacctat
ttacagaacggcaaaggcaagaagtatttccatgaaaattctgaattactcattccaaaa
gctacacacaatgacagtggctcctacttctgcagagggctcattggacacaacaacaaa
tcttcagcatcctttcgtataagcctaggcgatccagggtctccatccatgtttccaccg
tggcatcaaatcacattctgcctgctgataggactcttgtttgcaatagacacagtgctg
tatttctctgtgcggaggggtcttcaaagtcctgtggctgactatgaggaacccaagatt
caatggagcaaggaacctcaggacaagtga

DBGET integrated database retrieval system