KEGG   Mus musculus (mouse): 246696Help
Entry
246696            CDS       T01002                                 

Gene name
Slc25a28, Mfrn2, Mrs3/4
Definition
(RefSeq) solute carrier family 25, member 28
  KO
K15113  solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    246696 (Slc25a28)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    246696 (Slc25a28)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    246696 (Slc25a28)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   246696 (Slc25a28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr SAT
Motif
Other DBs
NCBI-GeneID: 246696
NCBI-ProteinID: NP_660138
MGI: 2180509
Ensembl: ENSMUSG00000040414
UniProt: Q8R0Z5
Position
19 C3; 19 36.67 cM
AA seq 364 aa AA seqDB search
MELEGRSAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGAYQPPVRLDPESG
PEYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR
IMRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA
TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA
IHFMTYEFLQEHFNPQRRYNPSSHVLCGACAGAVAAAATTPLDVCKTLLNTQESLALNSN
ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW
RAGK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggagttggaggggcggagtgcaggcggcgtggcgggaggaccagctgctgggcccggg
cggagccccggggagtcggcgctgctggacgggtggctgcagcggggcgtgggccggggg
gccggcggcggggaggcgggggcctatcagccccctgtacggctggatccggagtccggc
ccggaatacgaagcgctgccggctggagccactgtcaccacgcacatggtggcgggcgcc
gtggcagggatcctggagcattgcgtgatgtacccgatcgactgcgtcaagacccggatg
cagagcctacagcctgacccagccgcccgctatcggaacgtgttggaggctctctggaga
atcatgaggacagagggcctgtggaggcccatgcgggggctgaacgtcacagcaacaggc
gcggggcctgcccacgccctctattttgcctgctacgaaaagttaaaaaagacattgagt
gacgtaatccacccagggggcaatagccatattgccaatggtgcagccggatgtgtggcg
acattacttcatgatgcagccatgaatccagcggaagtcgtcaagcagaggatgcagatg
tacaactcgccgtaccaccgcgtgacagactgtgttcgggcagtgtggcaaaatgaaggg
gccggggccttttaccgcagctacacgacccagctgaccatgaatgtccccttccaagcc
attcacttcatgacctatgagttcctgcaagagcactttaacccccagagacggtacaac
cccagctcccatgtgctctgtggggcctgcgcaggagcagtagctgccgccgccacaacc
ccactggacgtttgtaaaacactgctcaacacccaggaatccctggctttgaactcaaac
attactggacacatcacaggcatggctagtgccttcaggacggtctatcaagtaggcggg
gtgactgcttacttccgaggggtgcaggccagagtcatttaccagatcccctccacagcc
atcgcatggtctgtgtatgaatttttcaaatacctaatcacaaagcggcaagaggaatgg
agggcaggcaagtga

DBGET integrated database retrieval system