KEGG   Mus musculus (mouse): 246703
Entry
246703            CDS       T01002                                 

Gene name
Naxe, AA087124, AI, AI-BP, AIBP, AP, Apoa1bp, Apoa1ip, ESTM3, ESTM37
Definition
(RefSeq) NAD(P)HX epimerase
  KO
K17759  NAD(P)H-hydrate epimerase [EC:5.1.99.6]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    246703 (Naxe)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.6  NAD(P)H-hydrate epimerase
     246703 (Naxe)
SSDB
Motif
Pfam: YjeF_N
Other DBs
NCBI-GeneID: 246703
NCBI-ProteinID: NP_659146
MGI: 2180167
Ensembl: ENSMUSG00000028070
Vega: OTTMUSG00000051870
UniProt: Q8K4Z3
Structure
PDB: 

Position
3; 3 F1
AA seq 282 aa
MSGLRTLLGLGLLVAGSRLPRVISQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQ
AVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLV
CARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDA
IFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKK
SATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtccgggctgcggacgctgctggggctggggctgctggttgcgggctcgcgcctgcca
cgggtcatcagccagcagagtgtgtgtcgtgcaaggcccatctggtggggaacacagcgc
cggggctcggagaccatggcgggcgctgcggtgaagtacttaagtcaggaggaggctcag
gccgtggaccaagagctttttaacgagtatcagttcagcgtggatcaactcatggagctg
gccgggttgagctgtgccacggctattgccaaggcttatccccccacgtctatgtccaag
agtcccccgactgtcttggtcatctgtggccccggaaataacggaggggatgggctggtc
tgtgcgcgacacctcaaactttttggttaccagccaactatctattaccccaaaagacct
aacaagcccctcttcactgggctagtgactcagtgtcagaaaatggacattcctttcctt
ggtgaaatgcccccagagcccatgatggtggacgagctgtatgagctggtggtggacgcc
atcttcggcttcagtttcaagggtgacgttcgggagccattccacagcatcctgagtgtc
ttgagtggactcactgtgcccattgctagcatcgacattccctcaggatgggatgtagag
aagggaaaccctagcggaatccaaccagacttactcatctcactgacggcacccaagaag
tctgcaactcactttactggccgatatcattaccttgggggtcgctttgtaccacctgct
ctagagaagaagtaccagctgaacctgccatcttaccctgacacagagtgtgtctaccgt
ctacagtaa

DBGET integrated database retrieval system