KEGG   Mus musculus (mouse): 246729Help
Entry
246729            CDS       T01002                                 

Gene name
Oas1h
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1H
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Motif
Other DBs
NCBI-GeneID: 246729
NCBI-ProteinID: NP_001153406
MGI: 2180853
Ensembl: ENSMUSG00000001168
Vega: OTTMUSG00000026828
UniProt: Q8VI97 E9Q326
Position
5 F; 5 60.64 cM
AA seq 239 aa AA seqDB search
MAKNLSSTRIALCSTPAWRLDKFIEGHLLGDITFLTELRTDVNSISAFLKERCFQGAAHP
MRVSRVVMGGSYNRYTVLKGRSEVDLLVFFNNLTCFDDQFKLQKEVIEEIQKHLCQFQQE
KRLREKFKVQSSDQPNFRSVSFKLSYPKFQQEVEFHMQTAYDALYEVRRKENHNCEIYNK
VYARLIRECTMLGKEGEFNICFMELQQDFLWKRPCELKNLICLVKHWYQLPDKKGFVFL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaccttagcagcactcggattgctctctgcagcactccggcttggaggttg
gataagttcatagagggtcacctccttggtgacatcaccttccttactgagctcagaaca
gacgtgaactccataagtgctttcctgaaggagagatgcttccaaggtgccgcccaccct
atgagggtctccagggttgtgatgggtggttcctacaatcgatacactgtgctcaagggc
aggtcagaggtcgacctattggtattctttaataatctcacctgctttgacgatcagttc
aagctacagaaagaggtcattgaggaaattcagaaacacctgtgccagttccagcaagaa
aaacgactgagagagaagtttaaggtccagagctcagaccagcccaactttaggtccgtg
agcttcaaactgagctaccccaagtttcagcaggaggtggaatttcatatgcagacagcc
tatgatgccctgtatgaagtgagaagaaaagagaatcataactgtgaaatctacaacaaa
gtatacgcccgactcatccgtgagtgcaccatgctgggcaaggagggcgagttcaacatc
tgcttcatggagcttcagcaagactttctgtggaaacgtccatgcgagctgaagaacctc
atttgtctggtcaagcactggtatcaactgccagacaaaaaaggatttgtcttcctgtga

DBGET integrated database retrieval system