KEGG   Mus musculus (mouse): 246730
Entry
246730            CDS       T01002                                 

Gene name
Oas1a, L, L3
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1A
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246730 (Oas1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246730 (Oas1a)
   05171 Coronavirus disease - COVID-19
    246730 (Oas1a)
   05164 Influenza A
    246730 (Oas1a)
   05162 Measles
    246730 (Oas1a)
   05168 Herpes simplex virus 1 infection
    246730 (Oas1a)
   05169 Epstein-Barr virus infection
    246730 (Oas1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     246730 (Oas1a)
Motif
Pfam: OAS1_C NTP_transf_2 SMODS DZF
Other DBs
NCBI-GeneID: 246730
NCBI-ProteinID: NP_660212
MGI: 2180860
Ensembl: ENSMUSG00000052776
Vega: OTTMUSG00000026831
UniProt: P11928
Position
5 F; 5 60.65 cM
AA seq 367 aa
MEHGLRSIPAWTLDKFIEDYLLPDTTFGADVKSAVNVVCDFLKERCFQGAAHPVRVSKVV
KGGSSGKGTTLKGKSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQHERRFRVKF
EVQSSWWPNARSLSFKLSAPHLHQEVEFDVLPAFDVLGHVNTSSKPDPRIYAILIEECTS
LGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVF
AWEQGNGCYEFNTAQGFRTVLELVINYQHLRIYWTKYYDFQHQEVSKYLHRQLRKARPVI
LDPADPTGNVAGGNPEGWRRLAEEADVWLWYPCFIKKDGSRVSSWDVPTVVPVPFEQVEE
NWTCILL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagcacggactcaggagcatcccagcctggacgctggacaagttcatagaggattac
ctccttcccgacaccacctttggtgctgatgtcaaatcagccgtcaatgtcgtgtgtgat
ttcctgaaggagagatgcttccaaggtgctgcccacccagtgagggtctccaaggtggtg
aagggtggctcctcaggcaaaggcaccacactcaagggcaagtcagacgctgacctggtg
gtgttccttaacaatctcaccagctttgaggatcagttaaaccgacggggagagttcatc
aaggaaattaagaaacagctgtacgaggttcagcatgagagacgttttagagtcaagttt
gaggtccagagttcatggtggcccaacgcccggtctctgagcttcaagctgagcgccccc
catctgcatcaggaggtggagtttgatgtgctgccagcctttgatgtcctgggtcatgtt
aatacttccagcaagcctgatcccagaatctatgccatcctcatcgaggaatgtacctcc
ctggggaaggatggcgagttctctacctgcttcacggagctccagcggaacttcctgaag
cagcgcccaaccaagctgaagagtctcatccgcctggtcaagcactggtaccaactgtgt
aaggagaagctggggaagccattgcctccacagtacgccctagagttgctcactgtcttt
gcctgggaacaagggaatggatgttatgagttcaacacagcccagggcttccggaccgtc
ttggaactggtcatcaattatcagcatcttcgaatctactggacaaagtattatgacttt
caacaccaggaggtctccaaatacctgcacagacagctcagaaaagccaggcctgtgatc
ctggacccagctgacccaacagggaatgtggccggtgggaacccagagggctggaggcgg
ttggctgaagaggctgatgtgtggctatggtacccatgttttattaaaaaggatggttcc
cgagtgagctcctgggatgtgccgacggtggttcctgtaccttttgagcaggtagaagag
aactggacatgtatcctgctgtga

DBGET integrated database retrieval system