KEGG   Mus musculus (mouse): 252838
Entry
252838            CDS       T01002                                 

Symbol
Tox, 1700007F02Rik
Name
(RefSeq) thymocyte selection-associated high mobility group box
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HMG_box HMG_box_2 YABBY Mitofilin
Other DBs
NCBI-GeneID: 252838
NCBI-ProteinID: NP_663757
MGI: 2181659
Ensembl: ENSMUSG00000041272
Vega: OTTMUSG00000004332
UniProt: Q66JW3
Structure
PDB: 
2CO9

Position
4; 4 A1
AA seq 526 aa
MDVRFYPPPAQPAAAPAAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPG
PSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQTMDLPEITV
SNMLGQDGALLSNSISVMQEIGNAEGAQYSSHPQMAAMRPRGQPTDIRQQASMMQPGQLT
TINQSQLSAQLGLNMGGTNVAHNSPSPPGSKSATPSPSSSVHEDECEDASKINGGEKRPA
SDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWD
GLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYTDPVDVKTSQPPQLVNSKPSVFH
GPSQAHSALYLSSHYHQQPGMTPQLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP
LQISPPLHQHLSMQQHQSLAMQQPLGSQLPMQVQTALHSPTMQQGFTLQPDYQTIINPTS
TAAQVVTQAMEYVRSGCRNPPPQPVDWSTDYCSSGGMQRDKALYLT
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggacgtaagattttatcctcctccagcccagcccgctgctgcgcccgccgctccttgt
ctgggaccttctccctgcctggacccctactattgcaacaagtttgacggggagaacatg
tatatgagcatgacagagccgagccaggactatgtgccagccagccagtcctaccctgga
ccaagtctggaaagtgaagattttaacatcccacccatcacgcctccctccctccctgac
cactctctggtgcacctgaatgaggtagaatccggttaccactctctgtgtcaccccatg
aatcacaatggcctgctcccgttccatccacaaaccatggacctgccagagatcacggtg
tccaacatgctgggccaagatggcgcactgctctccaattccatctctgtgatgcaagag
attgggaacgcagaaggagctcagtacagctcccatcctcagatggcagccatgaggccg
agaggccagcctacagacatcagacagcaggcaagcatgatgcagcccggccagctgacc
accatcaaccagtcgcagctgagcgcacagttgggcttgaacatgggaggaaccaatgtg
gcccacaactccccttctccacccgggagcaagtctgcaaccccttccccatccagctca
gtgcatgaggatgagtgtgaggatgcctccaagatcaatggaggagagaagcggcctgcc
tctgatatggggaaaaaacccaaaactcccaagaagaagaagaagaaggatcctaatgag
ccccagaagcctgtgtctgcctatgctttgttctttcgtgatacccaggctgccattaag
ggccagaatccaaatgctacttttggtgaagtatcgaagattgtggcatcaatgtgggat
ggcctaggagaagaacagaaacaggtctataagaagaaaaccgaggctgcaaagaaggaa
tacctgaagcagctagcagcatacagagccagccttgtatccaagagctacactgatcct
gttgatgttaagacatctcagccaccccagctggtcaactcaaagccgtcagtattccat
gggcccagccaggcccactcagctctgtacctaagttctcactatcaccaacaaccagga
atgactcctcagctcaccgccatgcatccgagcctccccagaaacatagcacctaagccc
aataaccaaatgccagtgactgtctccatagccaacatggctgtgtccccaccaccgccc
cttcagatcagcccacctcttcatcagcatctcagcatgcagcagcatcagtcgcttgcc
atgcagcagccccttgggagtcagctccccatgcaggtccagactgccttacactcgccc
accatgcagcaaggatttactcttcaacccgactatcagactattatcaaccctacatct
acagctgcacaagttgtcacccaagcgatggagtacgtgcgttctgggtgcagaaatccg
cccccacagcccgtggactggagtaccgactactgcagtagtgggggcatgcagagggac
aaagcgctgtatctcacctga

DBGET integrated database retrieval system