KEGG   Mus musculus (mouse): 252870Help
Entry
252870            CDS       T01002                                 

Gene name
Usp7, 2210010O09Rik, AA409944, AA617399, AU019296, AW548146, C80752, Hausp
Definition
(RefSeq) ubiquitin specific peptidase 7
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    252870 (Usp7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    252870 (Usp7)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    252870 (Usp7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    252870 (Usp7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    252870 (Usp7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     252870 (Usp7)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   252870 (Usp7)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    252870 (Usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Motif
Other DBs
NCBI-GeneID: 252870
NCBI-ProteinID: NP_001003918
MGI: 2182061
Ensembl: ENSMUSG00000022710
Vega: OTTMUSG00000035130
UniProt: Q6A4J8 F8VPX1
Position
16; 16 A1
AA seq 1103 aa AA seqDB search
MNHQQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVTLSDGHSNAEEDM
EDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYRDDDKSFSRRISHLFFHKENDWGFSNFMAWSEVTDP
EKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKN
IFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRYTVFKVLKN
SSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWT
IFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITLYPDKHGCVRDLLEECKKAVELGDKASGRLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFRE
VMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaacagcagcagcagcagcagcagaaagcgggcgagcagcagctgagcgag
cccgaggacatggagatggaagctggagatacagatgacccaccaagaattactcagaac
cctgtcatcaatgggaatgtaaccctgagtgatgggcacagcaacgcagaagaggacatg
gaggatgacaccagttggcgctccgaggcaacctttcagttcactgtcgagcgcttcagc
agactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagatt
atggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctc
cagtgcaatgctgaatctgactccacgtcgtggtcctgccacgcacaagcagtgctgaag
ataataaattacagggatgatgacaaatcattcagccggcgaatcagccacttgttcttc
cacaaggaaaacgactggggattctctaatttcatggcctggagtgaagtgactgatcct
gagaaaggattcatcgatgatgacaaagtcacctttgaagtttttgtacaggcagatgct
ccccatggagttgcgtgggactcaaagaagcatactggctatgtcggcttaaagaatcag
ggagcaacgtgttacatgaatagcttgctgcagaccttgtttttcacaaatcagttacga
aaggctgtgtacatgatgccaacagagggcgatgattcatctaaaagcgtccctttagca
ttacaaagagtgttctatgaattacagcacagcgataagcccgtaggaacaaaaaagctc
acaaagtcatttgggtgggaaactttagatagcttcatgcaacacgatgttcaagagctt
tgtcgagtgttgcttgataatgtggaaaataagatgaaaggcacctgtgtagagggcacc
attccaaagttattccgaggcaaaatggtgtcctatattcagtgcaaagacgtagactac
cgttctgataggagagaagattattatgatatccagctaagtataaaaggaaagaaaaac
atatttgaatcatttgtggattatgtggcagtagaacaactagacggtgacaataaatac
gatgctggggagcatggcctgcaggaggcagagaaaggtgtgaaattcctaacattgccc
ccagtgttacacctgcaacttatgaggttcatgtatgaccctcagacggaccaaaacatc
aagatcaatgacaggtttgagtttccagaacagttaccacttgatgaatttttgcaaaaa
acagaccctaaggaccctgcaaattatattctccatgcagtcttggttcacagtggagat
aatcatggtggacattacgtggtttacctaaaccccaaaggggatggcaaatggtgtaag
ttcgatgatgacgtggtatccaggtgtactaaagaagaagccattgagcacaattatggg
ggtcatgatgatgatctgtctgttcgacactgcacaaatgcctatatgttagtgtacatc
agggaatcaaagctaagtgaagtgttacaagctgtcaccgaccatgatattcctcagcag
ttggtggaacgattgcaagaagagaaaaggatcgaggctcagaagcggaaggagcggcag
gaagcccatctctacatgcaagtgcagatagttgcagaggaccagttttgtggccaccaa
ggaaatgacatgtacgacgaggagaaagtgaggtacactgtgttcaaggttctgaagaac
tcctccctggccgagtttgttcagagcctctcccagaccatggggtttccacaagatcag
attcgattatggcctatgcaagcaagaagtaatggaacaaagcggcctgcaatgttagat
aatgaagctgacggcaataaaacaatgattgaactgagtgataatgaaaacccttggaca
atattcctggaaacagttgatcctgagctggctgctagtggagcaacattgcccaagttt
gataaagatcatgatgtaatgttatttttgaagatgtatgatcctaaaacccggagcttg
aattactgtggacatatctacacacccatatcctgtaaaatacgtgacttgctcccggtt
atgtgtgacagagcaggatttatccaggatactagccttatcctctatgaggaagttaag
ccgaatttaacagagagaattcaggactatgatgtgtctcttgataaagcccttgatgag
ctgatggatggtgacatcatagtgtttcagaaggatgacccagaaaacgataacagtgag
ctgcccactgctaaagagtatttcagagatctctaccaccgggtcgacgtcatcttctgt
gacaaaacgatccccaatgaccctggatttgtggtcacattatcaaataggatgaactat
tttcaggttgcaaagacagttgcacagaggctcaacacagaccccatgctgctgcagttt
ttcaagtctcaaggttatagggacggccccggtaatcctcttaggcataattacgaaggt
actttaagagatcttctacaattcttcaagccaagacaacctaagaaactttactatcag
caacttaagatgaaaatcacagactttgagaacaggagaagttttaagtgtatatggtta
aacagccaatttagggaagaggaaataacactatacccagacaagcatggctgtgtccgg
gacctgttagaagaatgtaaaaaagccgtggagctcggtgacaaagcatcagggagactt
aggctgctagaaattgtgagctacaaaattattggtgtgcatcaagaagatgaactatta
gaatgcttatctcctgcaacgagtcggacttttagaatagaggaaatacctttggaccag
gtagacatagataaggaaaacgagatgctaatcacagtggcacatttccacaaagaggtg
tttgggacgtttggaattccatttttgctaaggatacaccagggtgagcatttccgagag
gtgatgaagcggatacagagcctgctggacatccaggagaaggagtttgaaaagtttaaa
tttgcaattgtcatgatgggccggcaccagtacatcaatgaagatgagtatgaagtaaat
ttgaaggactttgagccacaacctggtaacatgtctcatcctcggccttggctagggctt
gaccacttcaacaaagccccaaagaggagtcgctacacttacctagaaaaggcaattaaa
atccacaactga

DBGET integrated database retrieval system