KEGG   Mus musculus (mouse): 252875Help
Entry
252875            CDS       T01002                                 

Gene name
Mios, C81488
Definition
(RefSeq) meiosis regulator for oocyte development
  KO
K20407  WD repeat-containing protein mio
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    252875 (Mios)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zinc_ribbon_16
Motif
Other DBs
NCBI-GeneID: 252875
NCBI-ProteinID: NP_663349
MGI: 2182066
Ensembl: ENSMUSG00000042447
Vega: OTTMUSG00000023501
UniProt: Q8VE19 Q8BV62
Position
6; 6 A1
AA seq 875 aa AA seqDB search
MSGTKPDILWAPHQVDRFVVCDSELSLYHVESAVNSELKAGSLRLSEDSAATLLSINSDT
PYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLA
WNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVRLSAGEAETTLLVTKPLYE
LGQNDASLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRV
ASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQH
TPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAW
SPITSLMWACGRHLYECAEEESDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNED
PQLKSLWYTLHFMKQYTEDNDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQ
TDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQI
LNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSEAG
AYDGVLYENKVAVRDRVAFACKFLGDAQLNKYIEKLTNEMKEAGNLEGILLTGLTKDGVD
LMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHR
SKLDPSSKPLAQVFVSCNFCGKSISYSCSSVPHQGRGFSQYGVSGSPTKSKVTSCPGCRK
PLPRCALCLINMGTPVSSCPGGSKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHML
SWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtaccaagcccgatattttgtgggcaccacaccaagttgatagatttgttgta
tgtgactcagaattgagcctttatcatgtggaatcggctgtgaattcagaactcaaagct
ggatcgttacgtttatctgaagactctgcagcgacattgctgtcaataaactcagataca
ccctatatgaaatgtgttgcgtggtatctcaattatgatcctgaatgtctcctagcagtt
ggacaagcaaatggtcgagttgtacttacaagtcttggtcaagatcataactctaagttc
aaagatttgataggaaaagaatttgttccaaagcatgctcgccaatgcaatacccttgca
tggaatccactggatagtaactggcttgctgctggtctcgacaaacacagagctgacttt
tcagttctaatatgggatatctgcagcaaatatactcctgatattgttcccatggaaaaa
gtgagactttcagcaggtgaagctgaaacaacattactagtgacaaaaccgctgtatgag
ttagggcagaatgacgcttctctatctctgtgttggcttccacgagaccagaaacttctt
cttgctggcatgcatcgtaatctagcaatatttgatctccggaacacaagccagaagatg
tttgtaaatacaaaagctgttcaaggagtgacagtagacccttacttccacgatcgtgtt
gcttccttctatgaaggtcaggttgcaatatgggatcttagaaaatttgagaagccagtt
ttgactttgactgaacaaccaaagcccttgacaaaggtcgcatggtgtccaaccaggaca
ggcctgcttgctactttaacaagggatagtaatattattaggctgtatgatatgcagcat
acacccactcccatcggggatgaaaccgaacccacaataattgaaagaagtgtgcagcct
tgtgacaattacattgcttcctttgcatggcatccaacgagtcaaaatcgaatgatagtt
gtgactcccaaccgaacaatgtctgacttcactgtatttgaaaggatatctcttgcctgg
agcccaattacatctttaatgtgggcttgtggtcgccatttgtatgagtgtgcagaagaa
gaaagtgataactccttagaaaaagatatagcaacaaaaatgcgccttcgggctttatca
aggtatggacttgatacagaacaggtttggagaaaccacattttagctggcaatgaagac
ccacagctcaagtcactctggtatactctgcactttatgaagcaatatacagaagataat
gatcaaaaatctccaggcaacaaaggatcattggtttatgcaggaattaaatcaatagta
aaatcatctttgggaatggtagaaagcagcagacataattggagtggcttggataaacaa
actgatattcagaacttaaatgaagaaaggattttagcattacagctttgtgggtggata
aagaaaggaacggatgtagatgtagggccatttttgaactcccttgtgcaagaaggagaa
tgggaaagagctgctgctgtggctttgttcaacttggatattcggcgagcaatccaaatc
ctgaatgaaggggcgtcttcagaaaaaggagatctgaatctcaatgtggtggcaatggct
ttatcggggtatacggacgagaagaactcgctgtggcgggagatgtgcagcaccctgcgc
ctgcagctcaacaacccctatctgtgtgtcatgtttgcgttcctgacgagtgaagcgggg
gcatatgatggagtgttgtatgaaaacaaagttgctgtacgtgacagagtggcattcgct
tgtaaattccttggtgatgctcagttaaataaatacattgaaaagctgaccaatgaaatg
aaagaggctggaaatttggaggggatcttgcttacaggcctcactaaagatggagtggac
ctgatggagagctatgtggatagaactggagatgttcaaacagcaagttactgcatgtta
cagggttcacctttagatgttctgaaagatgaaagggttcaatattggattgagaattac
agaaatttattagatgcctggaggttttggcacaaaagggcagaatttgatattcatagg
agtaagctggatcccagttccaagcctttagcacaggtgtttgtgagttgtaatttttgt
ggcaaatcaatctcctacagctgttcctctgtgcctcatcagggcagagggtttagtcag
tatggtgtgagtggctcaccaacaaaatccaaagtcacaagctgccctggctgtcggaaa
ccccttcctcgatgtgcactttgcctcattaatatgggaacacctgtttctagctgtcct
ggtggatccaaatcagatgaaaaggtggacttgagcaaggacaaaaagttagctcagttt
aacaactggtttacctggtgtcacaactgtcggcatggtgggcatgccggacatatgctg
agttggttcagggaccatgcagagtgtcctgtatctgcatgcacgtgtaaatgtatgcag
ttggatacaacaggaaatctggtgccagcagagactgtccagccatga

DBGET integrated database retrieval system