KEGG   Mus musculus (mouse): 252909
Entry
252909            CDS       T01002                                 

Symbol
Vmn1r85, V1rj3
Name
(RefSeq) vomeronasal 1 receptor 85
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    252909 (Vmn1r85)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    252909 (Vmn1r85)
SSDB
Motif
Pfam: V1R TAS2R
Other DBs
NCBI-GeneID: 252909
NCBI-ProteinID: NP_665846
MGI: 2182262
Ensembl: ENSMUSG00000070817
Vega: OTTMUSG00000038212
UniProt: Q8VIB8
Position
7; 7 A1
AA seq 308 aa
MLFPSNTILGVFVISEFCVGVLGNSLLLMLYIFNFWVKARFNRQIDPIFMHLMIVNMLTI
IFAMIPYITSSFGVPSFLHDAGCKAFVYIYRVSRAMSISSTSILSTFQAITITPSNSKWA
WLKPKLSKWTFCTFLFSWFINMVIYVHLIENVIAKTNYTGVNYGYSHVYCESSPVEYPNP
GFFLGVIITRDLVLLVIMMWTSLSMVTLLYRHHKRAQHLRNPRLSSQKSPEHKATHTILL
LVNCFVFFYLLNNLITLYDRFYTRGRTGNLGAIITIVASFYPTLCPFLLMNSNKMYFFPS
YIQRAIGD
NT seq 927 nt   +upstreamnt  +downstreamnt
atgttgtttccaagcaacactatcttgggggttttcgtcatatctgagttttgtgtggga
gtcttagggaactcattgctcctcatgctgtatatattcaacttctgggtcaaagctcgc
tttaacagacagatcgatcccattttcatgcacctgatgatagtcaatatgttgacaatc
atatttgctatgataccatatatcacatcatcctttggagtgcctagttttctgcatgat
gctggctgtaaggcctttgtgtatatctatagagtctcccgggctatgtccatctctagc
acttctattctaagcacattccaggccatcaccatcactcccagtaattctaagtgggcg
tggcttaagcctaaactctctaagtggactttttgcaccttcctgttttcctggttcatc
aacatggtcatatatgtgcacctgattgagaatgtaatagcaaaaactaattacactggt
gttaattatggatattctcatgtttactgtgaaagtagtccagttgagtaccccaatcca
ggatttttcctcggcgttatcataacaagagaccttgtccttctggtcatcatgatgtgg
accagcctctccatggtgaccctcctctacaggcatcacaagagagcccagcatctccgc
aacccaagactctcctctcagaagtctccagaacacaaagccactcacacaatcctgttg
cttgtaaactgctttgtgttcttttatttgttgaacaacttaatcaccctttatgatagg
ttttatacacgtggaagaacaggaaatctgggggcaattatcacaattgtggcatcattt
taccctactctctgcccatttttactaatgaacagtaataaaatgtatttcttcccttcc
tatattcaaagagccattggtgactga

DBGET integrated database retrieval system