KEGG   Mus musculus (mouse): 252972Help
Entry
252972            CDS       T01002                                 

Gene name
Tpcn1, 5730403B01Rik, Tpc1, mKIAA1169
Definition
(RefSeq) two pore channel 1
  KO
K16896  two pore calcium channel protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    252972 (Tpcn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    252972 (Tpcn1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   252972 (Tpcn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Pilin_N
Motif
Other DBs
NCBI-GeneID: 252972
NCBI-ProteinID: NP_665852
MGI: 2182472
Ensembl: ENSMUSG00000032741
Vega: OTTMUSG00000056260
UniProt: Q9EQJ0
Structure
PDB: 

Position
5; 5 F
AA seq 817 aa AA seqDB search
MAVSLDDDVPLILTLDEAESAPLPPSNSLGQEQLPSKNGGSHSIHNSQVPSLVSGADSPP
SSPTGHNWEMNYQEAAIYLQEGQNNDKFFTHPKDARALAAYLFVHNHFFYMMELLTALLL
LLLSLCESPAVPVLKLHTYVHATLELFALMVVVFELCMKLRWLGFHTFVRHKRTMVKTSV
LVVQFIEAIVVLVRQTSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLL
LFFMIIFAILGFYLFSTNPSDPYFSTLENSIVNLFVLLTTANFPDVMMPSYSRNPWSCVF
FIVYLSIELYFIMNLLLAVVFDTFNDIEKHKFKSLLLHKRTAIQHAYGLLASQRRPAGIS
YRQFEGLMRFYKPRMSARERFLTFKALNQSNTPLLSLKDFYDIYEVAALQWKAKRNRQHW
FDELPRTAFLIFKGINILVNSKAFQYFMYLVVAVNGVWILVETFMLKGGNFTSKHVPWSY
LVFLTIYGVELFMKVAGLGPVEYLSSGWNLFDFSVTAFAFLGLLALTLNMEPFYFIVVLR
PLQLLRLFKLKKRYRNVLDTMFELLPRMASLGLTLLTFYYSFAIVGMEFFNGRLTPNCCN
TSTVADAYRFINHTVGNKTKVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQ
TSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKSQDSEVDSGIVIEKEMSKEE
LMAVLELYREERGTSSDVTRLLDTLSQMEKYQQNSMVFLGRRSRTKSDLSLKMYQEEIQE
WYEEHAREQEQQKLRGSVPGPAAQQPPGSRQRSQTVT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaagtttagatgacgatgtgccgctcatcctgaccttggacgaggctgagagt
gctccgctgcctccttcgaacagcctgggccaagagcagctgcccagcaaaaatgggggc
agccacagcatccacaactcccaggtccccagtctggtctccggagcggacagccccccc
tccagtcccaccggacacaactgggagatgaattatcaagaggcggcaatctacctccag
gaaggtcagaacaacgacaagttcttcacccaccccaaggatgccagagcgctggcggcc
tacctcttcgtccacaaccacttcttctacatgatggagctgctcacggccctgctcctg
ctgctgctgtcgctgtgcgagtcccccgctgtccccgtgctcaagctgcacacttacgtc
cacgccacgctggaactctttgccctcatggtggtggtatttgaactctgcatgaaattg
cggtggctgggcttccacacgttcgtccggcacaaacgtaccatggtcaagacgtccgtc
ctcgtggtgcagttcatcgaggccattgtggtgctggttcggcagacgtcccacgtgcgg
gtgacccgggcactacgctgcattttcctggtggactgtcgctactgtggcggtgtacgg
cgcaacctgcggcagatcttccagtctctcccacccttcatggacatcctcctgttgctg
ctcttctttatgatcatctttgccatcctcggtttctacttattctccacaaatccttcc
gacccctacttcagcaccctggagaacagcatcgtcaacctgttcgttctcctgaccaca
gccaactttccagatgtcatgatgccctcctactcccggaacccctggtcctgcgtcttc
ttcattgtatacctctccattgagctgtacttcatcatgaacctgctcctggccgtggtg
ttcgacaccttcaacgacattgaaaagcacaagttcaagtctttgctgctgcacaaacgg
accgccatccagcatgcctacggcctgcttgccagccaacggaggccggctggcatctcc
tacaggcagttcgaaggcttaatgcgcttctacaagccccggatgagtgcaagggaacgc
ttcctgactttcaaggccttgaaccagagcaacacgcctctgctcagcctgaaggacttc
tatgatatttacgaagtcgctgctctgcagtggaaggcaaagagaaacagacagcattgg
tttgatgagctcccccggacagccttcctcatcttcaaagggattaacatccttgtgaat
tccaaggccttccagtatttcatgtacttggtggtggctgtcaacggtgtctggatcctg
gtggagacattcatgttgaaaggtgggaatttcacctcaaagcatgtgccctggagttac
ctcgtgtttcttaccatctatggagttgaactgttcatgaaggtggctggcctgggccct
gtggagtacctgtcctctggatggaacctgttcgatttctcggtcacggcattcgccttc
ctgggactgctcgcactgacgctcaacatggaacccttctatttcattgtggtcctgcgt
ccccttcagctgctgaggttatttaaactgaagaaacgctaccgcaacgtgttggacacc
atgtttgagctgctgccgcggatggccagccttggcctcacgctgctcaccttctactat
tccttcgccatcgtgggcatggagttcttcaacgggcggctgacccccaactgctgcaac
accagcacagtggccgacgcctaccggttcatcaaccacactgtgggcaataagaccaag
gtagaggaaggctactactatctcaacaactttgacaacatcctcaacagcttcgtgacc
ttgtttgagctcaccgttgtcaacaattggtacatcatcatggaaggcgtcacctcgcag
acgtcccactggagccgcctgtacttcatgaccttttacatagtgaccatggtggtgatg
accattatcgtggccttcatcctggaggccttcgtcttccgcatgaactacagccgcaag
agccaggactcggaagtggacagtggcatcgtcatcgagaaggaaatgtccaaggaggag
cttatggccgtcctggagctttatcgtgaggagcgaggcacctcctctgacgtgacccgg
ctgctggacaccctctctcagatggagaaataccagcaaaattccatggtgtttctggga
cggcgatcgagaaccaaaagtgacctgagtctgaagatgtaccaggaggagatccaggag
tggtacgaggagcatgcccgggaacaggagcagcagaagctcaggggcagcgtgcccggc
cctgcagcccagcagccccctggcagtcgccagcgctcccagactgtcacctag

DBGET integrated database retrieval system