KEGG   Mus musculus (mouse): 257632Help
Entry
257632            CDS       T01002                                 

Gene name
Nod2, ACUG, BLAU, CD, Card15, F830032C23Rik, IBD1, Nlrc2
Definition
(RefSeq) nucleotide-binding oligomerization domain containing 2
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
mmu05152  Tuberculosis
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    257632 (Nod2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    257632 (Nod2)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    257632 (Nod2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    257632 (Nod2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    257632 (Nod2)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   257632 (Nod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT CARD LRR_6 NLRC4_HD2 NOD2_WH LRR_4 AAA_22 AAA_29 AAA_25 AAA_16 AAA_30 NB-ARC AAA_33 G-alpha ABC_tran AAA_15
Motif
Other DBs
NCBI-GeneID: 257632
NCBI-ProteinID: NP_665856
MGI: 2429397
Ensembl: ENSMUSG00000055994
Vega: OTTMUSG00000029844
UniProt: Q80SY9
Position
8; 8 C3
AA seq 1013 aa AA seqDB search
MCSQEEFQAQRSQLVALLISGSLEGFESILDWLLSWDVLSREDYEGLSLPGQPLSHSARR
LLDTVWNKGVWGCQKLLEAVQEAQANSHTFELYGSWDTHSLHPTRDLQSHRPAIVRRLYN
HVEAMLELAREGGFLSQYECEEIRLPIFTSSQRARRLLDLAAVKANGLAAFLLQHVRELP
APLPLPYEAAECQKFISKLRTMVLTQSRFLSTYDGSENLCLEDIYTENILELQTEVGTAG
ALQKSPAILGLEDLFDTHGHLNRDADTILVVGEAGSGKSTLLQRLHLLWATGRSFQEFLF
IFPFSCRQLQCVAKPLSLRTLLFEHCCWPDVAQDDVFQFLLDHPDRVLLTFDGLDEFKFR
FTDRERHCSPIDPTSVQTLLFNLLQGNLLKNACKVLTSRPDAVSALLRKFVRTELQLKGF
SEEGIQLYLRKHHREPGVADRLIQLIQATSALHGLCHLPVFSWMVSRCHRELLLQNRGFP
TTSTDMYLLILQHFLLHASPPDSSPLGLGPGLLQSRLSTLLHLGHLALRGLAMSCYVFSA
QQLQAAQVDSDDISLGFLVRAQSSVPGSKAPLEFLHITFQCFFAAFYLAVSADTSVASLK
HLFSCGRLGSSLLGRLLPNLCIQGSRVKKGSEAALLQKAEPHNLQITAAFLAGLLSQQHR
DLLAACQVSERVLLQRQARARSCLAHSLREHFHSIPPAVPGETKSMHAMPGFIWLIRSLY
EMQEEQLAQEAVRRLDIGHLKLTFCRVGPAECAALAFVLQHLQRPVALQLDYNSVGDVGV
EQLRPCLGVCTALYLRDNNISDRGARTLVECALRCEQLQKLALFNNKLTDACACSMAKLL
AHKQNFLSLRVGNNHITAAGAEVLAQGLKSNTSLKFLGFWGNSVGDKGTQALAEVVADHQ
NLKWLSLVGNNIGSMGAEALALMLEKNKSLEELCLEENHICDEGVYSLAEGLKRNSTLKF
LKLSNNGITYRGAEALLQALSRNSAILEVWLRGNTFSLEEIQTLSSRDARLLL
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcacaggaagagttccaggcacagaggagccagctggtggcactgctgatctca
gggtccttggagggctttgagagcatcttagactggctgctgtcttgggatgtgctctcc
agggaggactatgagggcctcagcctccctggccaacctctctcccattctgccaggcgt
ctgctggacacagtctggaacaagggtgtttggggctgtcagaagctcctcgaagctgtg
caggaggcacaggccaacagtcatacctttgaactgtatgggtcctgggacactcactcc
cttcatccaaccagagacctgcagagtcaccggccagccattgtgaggagactctacaac
catgtagaagccatgctggagctggcaagggagggggggtttctgagccagtacgagtgt
gaggagatcaggctgccaatcttcacgtcgtctcagagggcaagaaggctgcttgatctc
gctgcggtgaaggccaatggactggctgccttccttctacagcacgtcagggaactacca
gctccactgcctctgccttacgaggctgctgagtgtcagaagttcatatctaagctgagg
accatggtgttgactcagtctcgcttcctcagtacttacgatgggtcggagaatctttgc
ctggaggatatatacacggagaacatcttggagctgcagactgaagtgggcacagccggg
gccttgcagaagagccctgccatcctgggcctggaggacctctttgatacccatggtcac
ctgaacagagatgccgacaccatactggtggtgggcgaagcaggcagtggcaagagcact
cttctgcagcgtttgcacctgctgtgggcaacagggaggagcttccaggagtttctcttc
attttcccattcagctgccgacagttgcaatgcgtggccaaaccgctgtccctgaggacg
ctgctctttgagcactgctgctggcctgatgtcgctcaggacgatgtcttccagttcctt
cttgaccatcctgaccgtgtcctgttaacctttgatggcttggacgagttcaagttccgg
ttcaccgaccgggagcgccactgctctccaattgaccccacgtcagtccagactctgctc
ttcaaccttctccaggggaacctgctgaagaatgcctgcaaggtgctgaccagccgtccg
gatgctgtgtcagcgctcctcaggaagttcgttcgcacagagttgcaactgaagggcttc
tctgaagagggcatccaactgtacctgagaaagcaccaccgggaacctggggtggcagac
cgcctcatccagctgatccaagccacctcagccctgcatggtttgtgccacctccctgtc
ttctcttggatggtgtccagatgccaccgggaacttctgctgcagaacaggggcttccca
acaaccagcacggacatgtacctcctgatcctgcagcatttcctgctgcatgcctcccct
ccggactcctccccactcggtctgggacctggactcctccaaagccggctctccaccctc
ctgcaccttggccacctggctctccggggcctggccatgagctgctatgtgttctcagcc
cagcagctccaggcagctcaggttgactctgatgatatttctcttggtttcctggtacgt
gcccaaagtagtgtgcccgggagcaaggcgcccctggagttcctgcacattaccttccag
tgcttttttgccgctttctacttggctgtcagtgctgacacatcggtggcctctctcaag
caccttttcagctgtggccggctgggcagctcactgctgggaaggctgctgcccaacctg
tgtatccagggctccagagtcaagaagggcagcgaagcagccctgctgcagaaggctgag
ccacacaacctgcaaatcacagcagccttcctagcaggtctgttgtcccagcagcatcgg
gacctgttggctgcatgccaggtctccgagagggtactgctccagcgtcaggcacgtgcc
cgctcgtgtctggcccacagcctccgcgagcacttccattccatcccgcctgccgtgccc
ggtgagaccaagagcatgcatgctatgccgggcttcatttggctcatccgtagcctgtac
gagatgcaggaggagcagttggcccaggaggctgtccgtcgcttggacatcgggcacctg
aagttgacattttgcagagtgggccctgcagagtgtgctgcactggcctttgtactgcaa
catctccagcggcctgtggccctacagctggattacaactctgtgggagatgttggagtg
gaacagctgcgaccgtgccttggggtctgcacagctctgtatttgcgagataacaatatc
tcagaccgaggtgcccgcacgctggttgagtgtgctcttcgctgtgagcagctgcagaaa
ctagctctcttcaacaacaaactcacggatgcgtgcgcctgctccatggccaagctcctt
gcacacaagcagaacttcttgtccctgagggtggggaacaatcacatcacagccgctgga
gccgaggtgctggcccagggactcaagagcaacacctccctgaagttcctggggttctgg
ggcaacagcgtgggtgataagggcacccaagccctggctgaagttgtagccgaccaccag
aacctaaagtggctcagcctggtaggaaacaacattggcagcatgggtgccgaagcccta
gcactgatgctggagaagaacaagtcactagaggaactctgcctagaggaaaaccatatc
tgtgacgaaggggtatattctctcgcagaaggactcaagagaaattcaactttgaaattc
ttgaaactgtccaacaatggcatcacctaccggggtgcagaagccctcctgcaggccctc
agcaggaacagtgccattctggaggtttggcttcgagggaacacattctctttggaggaa
atccaaacactgagctccagggacgccagactcttgttgtga

DBGET integrated database retrieval system