KEGG   Mus musculus (house mouse): 257635
Entry
257635            CDS       T01002                                 
Symbol
Sdsl, 4432411H13Rik, SDH1, SDS-RS1, TDH
Name
(RefSeq) serine dehydratase-like
  KO
K17989  L-serine/L-threonine ammonia-lyase [EC:4.3.1.17 4.3.1.19]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu00290  Valine, leucine and isoleucine biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    257635 (Sdsl)
   00270 Cysteine and methionine metabolism
    257635 (Sdsl)
   00290 Valine, leucine and isoleucine biosynthesis
    257635 (Sdsl)
Enzymes [BR:mmu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     257635 (Sdsl)
    4.3.1.19  threonine ammonia-lyase
     257635 (Sdsl)
SSDB
Motif
Pfam: PALP AIRC TPP_enzyme_N
Other DBs
NCBI-GeneID: 257635
NCBI-ProteinID: NP_598663
MGI: 2182607
Ensembl: ENSMUSG00000029596
Position
5:complement(120596258..120610890)
AA seq 329 aa
MEGALAERVGAEPFHRVTPLLESWALSQVAGMPVFLKYENVQIAGSFKIRGIGHFCQQMA
KRGCRHLVCSSGGNAGIAAAYSARKLGIPVTIVLPEGTSVQVVRRLEGEGAEVQLTGKVW
DEANVKAQELATRDGWVNVSPFDHPLIWEGHASLVRELKESLGTPPGAVVLAVGGGGLLA
GVTAGLLEVGWQHVPIVAMETRGAHSFNSALQAGRPVTLPDITSVAKSLGAKTVAARTLE
CAKECEVLSEVVEDREAVSAVQRFLDDERMLVEPACGAALAAIYSGILWRLQAEGRLSSA
LASVVVIVCGGNNISSQQLQELKIQLGCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atggagggggccttggcagaacgcgtcggggcggagcctttccacagggtcacgcccctg
ctggagagctgggcgctgtctcaggtggcaggcatgccggtcttcctcaaatatgagaat
gtgcagatagctggctcctttaagattcggggcatcggacatttctgccagcagatggcc
aagaggggatgcagacatctggtgtgctcctcagggggcaatgcgggcattgcggctgca
tactcggctcgtaagctgggcatccccgtcaccatcgtgctcccagagggcacctccgtg
caggtggtgaggcggctcgagggggaaggggccgaggtccagctgactgggaaagtctgg
gatgaagccaatgtaaaagcacaagaactggccacaagggatggctgggtgaacgtctcc
ccgtttgaccatccccttatatgggaaggccatgccagcctagtgcgggagctgaaggag
tcactagggacccctccaggtgctgtggtgctggccgtggggggcggagggctcctggca
ggtgtgactgctggcctgctggaggtgggctggcagcatgtgcccatcgttgccatggag
acccgcggggcgcacagtttcaattcggccttgcaggcaggcaggccggtcaccctgcca
gacatcaccagtgtagccaagagcctcggagccaagacggtggctgcacggaccttggag
tgtgcaaaggagtgtgaggtcctctctgaggtggtagaagaccgggaggctgtcagcgct
gtgcagaggttcctggacgatgagcgcatgctggtggaacctgcctgcggtgccgccctg
gccgccatctactcgggcatcctgtggaggctccaggctgagggccgcctgagttctgcc
ctagcttccgttgtggtcatcgtgtgcggtggcaacaacattagtagccaacagcttcag
gagctgaaaatccagctgggctgcagctga

DBGET integrated database retrieval system