KEGG   Mus musculus (mouse): 257889
Entry
257889            CDS       T01002                                 

Gene name
Olfr132, MOR256-, MOR256-49
Definition
(RefSeq) olfactory receptor 132
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    257889 (Olfr132)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    257889 (Olfr132)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    257889 (Olfr132)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 257889
NCBI-ProteinID: NP_001005481
MGI: 2177515
Ensembl: ENSMUSG00000067186
Vega: OTTMUSG00000037356
UniProt: Q7TRI8
Position
17; 17 B1
AA seq 313 aa
MGTVCNDTHGDFILRGFSDKPYLEKVLFGVILVFYCLTLAGNTIIIFVSLKDPKLQIPMY
FFLSNLSLLDICFTSSCVPQMLVNLRSPKKTITYSGCATQLYIFLWLGATECVLLVVMAV
DRYVAVCHPLRYVTVMHPKVCLQLAVLAWGSGLIQSLIQSTATLRLPFCSQRVVDNIVCE
VPALIQLSSADTTYNEVQMSIASVILLVLPLAIILSSYGAIVKSVLKIKSPAGQKKAFGT
CTSHLLVVSLFYGTVTGVYLQPKTHYAHEWGKFLTLFYTVITPTLNPLIYTLKNKEVKEA
VIRLWWKTWISQR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggcacagtttgcaatgacacccatggtgatttcatcctccgtggcttctctgacaag
ccatatttagagaaggtactttttggggtaattttggtcttttattgtttgactcttgct
ggaaatacaatcataatatttgtttccttgaaggacccaaaactacagatccctatgtat
ttcttcctttccaatctttccttattagatatttgtttcaccagcagctgtgttcctcag
atgttggttaatttgagaagtccaaagaaaactatcacctatagtggctgtgccactcag
ctctacatcttcctgtggcttggtgccactgaatgtgtgcttcttgttgtcatggccgtg
gaccgctatgtggcagtgtgccatcctctgagatatgtaactgtcatgcaccctaaagta
tgtctgcagctggctgtccttgcttggggttctggcttgattcagtctctgatccaatct
actgctaccctcaggttgcccttttgctctcagcgggtagtagataacattgtgtgtgaa
gttccagccctgattcagctgtccagtgcagatactacctacaatgaagtgcagatgtcc
atagccagtgttatcctcctagtgttacccttggccattatcctttcctcctatggtgct
attgtgaaatctgttttgaagataaagtcacctgcagggcagaaaaaagcatttggcacc
tgtacttctcaccttcttgttgtttccctgttctatggtacagtaacaggtgtctatctt
caacccaagactcactatgctcatgaatggggaaagtttctcacacttttctacactgta
ataactccaactcttaaccctctcatttatacactgaagaacaaggaggtaaaagaagca
gtgataagactgtggtggaagacttggatttcacaaagataa

DBGET integrated database retrieval system