KEGG   Mus musculus (house mouse): 257892
Entry
257892            CDS       T01002                                 
Symbol
Or2ab1, MOR102-2, Olfr324
Name
(RefSeq) olfactory receptor family 2 subfamily AB member 1
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    257892 (Or2ab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    257892 (Or2ab1)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    257892 (Or2ab1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 257892
NCBI-ProteinID: NP_001011743
MGI: 3030158
Ensembl: ENSMUSG00000056564
UniProt: Q5NCC7
Position
11:58488171..58489292
AA seq 333 aa
MWGPSISSRLDRYGSAAGLSPENSSTITELVLVGFSDQPQTEIPLFIFFSLVYLASCLGN
TAVVILVALDVSLQTPMYFFLCHLAFLNGFFSTVVTPKMLFNFLASRKVISYPFCLAQTY
LTLFLESTECFLLAVMAIDRYVAICYPLRYLLIMSWAVCIALAVAVWVTGFCASVLPLCF
MILPLCSPYVVDYLFCELPILLHLFCADTSLQEAMMAVGGAGTVLVPFLLIALSYLRILV
TVIRIDSAEGRKKAFSTCASHLAVVTIYYGTGLIRYLRPKSLYSAEGDKLISVFYAVIGP
ALNPFIYSLRNKEVQGAVRRVVERYRKSPRIAF
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtgggggccttcgatttcttctcgtttggacaggtatggctcagccgcaggcctgagc
cccgagaattccagcaccatcaccgagctagtccttgtggggttttctgatcaaccccag
actgagattcctctcttcatcttcttctctctggtctacctagccagctgtttggggaat
acagctgtggtcatattagtggctctcgatgtctctctgcagacacccatgtatttcttc
ctctgccacctagctttcctcaatggattcttcagcacggttgtgactccaaagatgctc
ttcaatttccttgcaagcaggaaggtcatatcttacccattctgcctggctcagacctac
ctcaccctgttcttggagtcgaccgagtgctttctccttgccgtgatggccatagatcgc
tacgtggccatctgctacccactgaggtaccttctcatcatgagctgggcagtgtgcata
gcactggcagtggccgtgtgggtcacaggtttttgtgcctcggttttacctctctgcttc
atgatcctcccactctgtagcccttacgttgttgattatcttttctgcgagctgcctatc
cttctgcacctgttctgtgcagacacgtctctgcaggaggccatgatggccgttggaggg
gctggcacggtgctggttcccttcctcctgattgcgctctcctaccttcgcatcctggtg
actgtgataagaatagactcggctgaggggagaaagaaggccttttcaacctgtgcctcg
cacttggctgtggtgaccatctattacggaacggggctcatcaggtacttgaggcccaag
tccctttactccgccgagggagacaaactgatctctgtgttctatgcggtcatcggaccc
gcgctgaatccattcatctatagcctgcggaacaaggaagtgcagggtgctgtgaggaga
gtggtggagagatacaggaaaagcccaagaattgccttctag

DBGET integrated database retrieval system