KEGG   Mus musculus (house mouse): 257909
Entry
257909            CDS       T01002                                 
Symbol
Or4q3, MOR243-1, Olfr735
Name
(RefSeq) olfactory receptor family 4 subfamily Q member 3
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    257909 (Or4q3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    257909 (Or4q3)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    257909 (Or4q3)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 257909
NCBI-ProteinID: NP_001011754
MGI: 3030569
Ensembl: ENSMUSG00000046210
UniProt: Q7TRM4
Position
14:complement(50582833..50583897)
AA seq 354 aa
MVHADKQEVLSHNFSFLFNLTYLVQFNFSSTRSLDTLGLEKNKNSSDVSRFVLLGLSSSW
ELQLFLFFTFLLIYLVIVLGNLLIVMVVQADAHLFQSPMYYFLSHLSFIDLCLSCVAVPK
MLGDFLQKEKTISFSGCLAQVFFLHFLGASEMFLLTVMAYDRYVAICNPLHYLTVMNNHL
RLRLVFGCWCGGFIHSITQVMIVIQLPFCGPNELDNFYCDVPQVVKLACMDTYLVEVLMV
SNSGILSLVCFLVLLFSYALILITLRTHLHRGQSKALSTCASHLTVVSLIFVPCVFIYLR
PFCTFSVDKVVSVFYTVITPMLNPLIYTLRNADMKQAIEKLRKKQVASHCFAKG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggtacacgcagacaagcaagaagtactttctcataatttttcatttttgtttaattta
acctacttagtccagtttaatttttcttccactaggtcgcttgatactcttggcttggag
aaaaacaaaaacagctctgatgtgtcacgatttgtgcttctgggcctgtcgtcttcctgg
gagctccagttgtttctcttcttcacatttttgttgatttacctggttattgtcctggga
aatcttttgatagtgatggtcgtccaggctgatgctcacctgttccagtcacccatgtac
tattttctaagccatctgtctttcattgacctttgcctgagctgtgtggctgtacccaaa
atgctaggagatttcctacagaaggagaagacaatatctttttcaggatgcctggcccag
gtattctttcttcactttcttggagccagtgagatgttcctgttgactgttatggcctat
gataggtatgttgccatatgcaaccctttgcactacctgacggtcatgaataaccaccta
cgacttcggttggtgtttggctgctggtgtggaggtttcattcactctatcacacaggtc
atgattgtcattcagctgcctttttgtggtcccaatgaactggacaacttctactgtgat
gtcccccaggttgtcaagctggcctgcatggacacttacttggttgaggtgctgatggtc
tctaacagtggcatactgtctcttgtctgcttcttggtcctgctcttctcctatgctctc
atcttgattactctgagaactcacctccaccggggccagagcaaggcactgtccacctgt
gcttctcacttgacggtggtcagcctgatctttgtaccctgtgtattcatttacttgagg
cctttctgtaccttctctgtggataaagtagtctctgtgttttacacagtgatcacacct
atgctgaaccccctcatctatacactcagaaatgcagacatgaagcaagccatagaaaag
ctgagaaagaagcaagtggcatcccactgctttgctaaaggatga

DBGET integrated database retrieval system