KEGG   Mus musculus (house mouse): 257975
Entry
257975            CDS       T01002                                 
Symbol
Or52ab7, MOR23-4P, MOR23-5, Olfr598
Name
(RefSeq) olfactory receptor family 52 subfamily AB member 7
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    257975 (Or52ab7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    257975 (Or52ab7)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    257975 (Or52ab7)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 257975
NCBI-ProteinID: NP_001011793
MGI: 3030432
Ensembl: ENSMUSG00000073951
Position
7:102977695..102978654
AA seq 319 aa
MLSSLKTNNVTYLNPGTVILIGIPGLEHVQFWIGFPFFTVCLVALLGNIILLIIIPAEHS
LHQPMYIFLAVLAATDIGLCAAIAPKMLAIFWFRAYSMAFDACLAQLFFIHTLQGMESGI
LLAMAFDRYIAICDPLRHTSILTPSILGRMIVVVVIRAVVLVGLLPILIKRLHHFRSIQI
AHSYCEHMAVVKLAADDVQVNKICGLFVGFSVLGFDMVFIIISYALIFQAVFRLKQKEAR
LKAFNTCTAHIFVFLEFYILAFFSFFSHRLGHVVPSTHILLSTIYLLLPPALNPIVYGVK
NMVIRKRVAQIFFLDHAHQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atgctgagctccctgaaaaccaataacgtgacatatctgaaccctggaactgtaatattg
attggaattcctggactagagcacgtgcagttttggattggatttccattctttacagtg
tgtctggtggctcttttgggaaatatcattttattaatcatcatcccagccgagcatagc
ttacaccaacccatgtacatcttcctggctgtgctggcagctacagacataggactttgt
gcagccattgcccccaaaatgttggccatattttggttcagggcttattccatggccttt
gatgcctgcctagcccaactcttcttcatccatacccttcagggcatggagtccggcatt
ctgttggcaatggcttttgatcgatacattgcaatctgtgatcctctgaggcacacatct
attcttacaccctcaattcttggtcggatgatagtggtggtggtaattcgagcggtagtg
cttgtaggcctgttacctattctaataaaaagactgcaccattttcggtccattcaaatt
gcccactcttactgtgaacacatggctgtggtgaagcttgcagcagatgatgtacaggtc
aataagatatgtggtctctttgtggggtttagcgttctgggatttgacatggtttttatc
atcatatcatatgccctgattttccaagcagtttttcgccttaaacagaaggaggcaagg
ctcaaagcctttaacacctgcacagctcatatttttgtttttttagagttctatattctt
gcctttttctccttttttagccaccgtcttggccatgttgttccctccactcacattctt
ctgtcaaccatctacctcctcttgcctcctgctctcaaccctattgtgtatggagtgaaa
aacatggtcattcgaaagcgggtggcacagatcttttttctagatcatgcacatcagtag

DBGET integrated database retrieval system