KEGG   Mus musculus (mouse): 257979Help
Entry
257979            CDS       T01002                                 

Gene name
Olfr1281, MOR248-14P, MOR248-18
Definition
(RefSeq) olfactory receptor 1281
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    257979 (Olfr1281)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    257979 (Olfr1281)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    257979 (Olfr1281)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 257979
NCBI-ProteinID: NP_001005568
MGI: 3031115
Ensembl: ENSMUSG00000095156
Vega: OTTMUSG00000015193
UniProt: Q7TQY6
Position
2; 2 E3
AA seq 305 aa AA seqDB search
MEDSNQTVVSEFIFQGLCTSRQLEIFLLLPFSVLYLVTLVGNLFVVILIIIDHHLHSPMY
FLLANLSFVDFCLSSVNTPKLTIDLLKENKTISFGGCMSQILCVHFFGGSEMVLLVTMAY
DRYVAICRPLHYSSIMDRQKCIWLVVISWIVGFVHAISQLLLILDLPFCGPRVIDSFFCD
IPLVMKLACMNTDTLEILINADSGILATSCFTLLLISYTYILLTVQHRSKDGSSKALSTC
TSHIIVVLLFFGPIIFIYLWPVNITWVDKFLAVFYTVITPLLNPAIYTLRNKDIKNAIKK
LTNHM
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaagactctaatcaaactgtggtttctgagtttatttttcagggactgtgtacctca
aggcaacttgagatctttctcttattaccattttctgtcctctatctggtgactttggta
ggaaacctctttgtagtgatattgatcatcattgatcatcatctccattctcccatgtac
ttcctgttagctaatctatcatttgttgacttctgcctttcctcagtaaatacacccaaa
ctgaccatagatctcctaaaagaaaataaaaccatttcctttggcggctgcatgagccag
atcctctgtgtgcatttctttggaggaagtgagatggtgcttcttgtaacaatggcctat
gaccggtatgtggccatctgcaggccactccactacagcagcatcatggacagacagaag
tgcatctggctcgttgtgatatcatggattgttggatttgtgcatgccattagtcagttg
ctcttgattttggatctaccattctgtggacctagagtgatagacagctttttctgtgat
attcctttggtgatgaaattagcctgcatgaatactgatactctggaaatcctaataaat
gctgacagtggcattttagcaacttcttgtttcactctcttactgatatcttatacttat
attctattaactgttcaacatcgctctaaagatggctcatcaaaagcactatccacatgc
acatcccatatcatagtggttctgctgttctttgggcccatcatttttatctatctgtgg
ccagtaaacatcacttgggtggacaagtttcttgctgtgttttatacagtcatcacacct
ctcctgaatccagcaatctatacactgagaaataaagatattaaaaatgctataaagaaa
ctgacaaatcacatgtga

DBGET integrated database retrieval system