KEGG   Mus musculus (mouse): 258051
Entry
258051            CDS       T01002                                 

Gene name
Olfr93, MOR256-, MOR256-39P
Definition
(RefSeq) olfactory receptor 93
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258051 (Olfr93)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258051 (Olfr93)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258051 (Olfr93)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv Sugar_tr 7TM_GPCR_Srbc 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258051
NCBI-ProteinID: NP_001011813
MGI: 2177476
Ensembl: ENSMUSG00000091601
Vega: OTTMUSG00000037325
UniProt: Q6UAH1
Position
17; 17 B1
AA seq 312 aa
MVNQSTPVGFLLLGFSEHPQLEKVLFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFF
LSNLSFLDLCFTTTCVPQMLFNLWGPTKTISFLGCSVQLFIFMLLGTTECILLTVMAFDR
YVAVCQPLHYATIIHPRLCRQLAGVAWAIGLVQSIVQIPPTLTLPFCSHRQIDDFLCEVP
SLIRLSCGDTTFNEIQLSVAGVIFLLVPLSLIIVSYGVIARAVLKTNSSKGRRKAFGTCS
SHLIVVTLFYSSVIAVYLQPKNPYAQERSKFFGLFYAVGTPTLNPLVYTLRNKEVKRAFW
RLLGKDAASGRN
NT seq 939 nt   +upstreamnt  +downstreamnt
atggtcaaccagagcacccccgtgggcttcctcctcctgggcttctctgaacacccacaa
ctggaaaaggttctcttcgtcgttgtcttgtgctcctacctcctcaccctcctaggaaac
acactcatcctcctgctgtccaccctggaccccaggctccactctccaatgtacttcttc
ctctctaacctctccttcttggacctctgcttcaccacaacctgtgttccccagatgttg
ttcaacctctggggccccacaaagaccatcagcttcctgggatgctctgtccagctcttc
atcttcatgctcctggggacaacagagtgcatcctgttgacagtaatggcctttgaccgc
tatgtggctgtctgtcagcccctgcactatgccaccataatccacccccgcctatgtcgc
cagttggcaggtgtggcctgggctataggtttggtccaatccatagttcaaataccaccc
accctcacactgcccttctgttcccataggcaaatagatgactttctgtgtgaagtccca
tctctaatccgactctcttgtggggacaccacttttaatgagattcagttgtcagttgca
ggtgtcatcttcctgcttgtacctctgagcctcatcattgtctcttatggtgtcattgcc
agggctgtactaaaaactaactcttcaaaagggcgcagaaaagcttttgggacctgttca
tcccacctcattgtggttaccctcttttacagctcagtcattgctgtctatctgcagccc
aaaaatccctatgcccaagagagaagcaagttctttggtctcttttatgcagtgggtact
cccacactcaaccctcttgtatataccctgaggaacaaggaggtaaagagggcattctgg
aggctgctggggaaggatgcggcttctggaagaaactaa

DBGET integrated database retrieval system