KEGG   Mus musculus (mouse): 258096
Entry
258096            CDS       T01002                                 

Gene name
Olfr112, 4930580F03Rik, MOR218, MOR218-4
Definition
(RefSeq) olfactory receptor 112
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258096 (Olfr112)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258096 (Olfr112)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258096 (Olfr112)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258096
NCBI-ProteinID: NP_001013593
MGI: 2177495
Ensembl: ENSMUSG00000051611
Vega: OTTMUSG00000037461
UniProt: Q8C0S2 Q8C1J3
Position
17; 17 B1
AA seq 320 aa
MIVENITTMRGFLLMGFSDNHELQIVQAVLFLVTYLVGSAGNVIIITITTLDPQLQSPMY
YFLKHLSILDLSSLSVTVPQYVDSSLAQSGYISYAQCMLQIFFFTAFAWGELAILTVMSY
DRYVAICLPLHYEVIMSPRKCTWAVATVWLSGGISGTLYITGTLFIRFCGDKIIHQFFCD
VPQLLKLSCSNDHLVIMDMVSFLTAVSFACFTGIVISYVHIFSTVLRMPSAESRSKVFST
CLPHLFVVSLFLSTGAFAYLNLTSDSSTALEFLLSIFYTVLPPTLNPVIYSLRNETIKNV
VRKLLLSTKFTVRIIFSCCF
NT seq 963 nt   +upstreamnt  +downstreamnt
atgatagtggaaaatataaccacaatgagaggattcctcctcatgggattctctgacaac
catgagctgcagatcgtacaggctgtgctcttcttggtgacatacctagtcggctcagca
gggaacgtcatcattatcaccatcacaacactagacccacagctccagtctccaatgtat
tactttctgaagcacctttccattctggacctctcatccctctctgtcacagttccccag
tatgttgacagttccctggcacaaagtggctacatttcatatgcacagtgcatgctgcag
atttttttcttcacagcttttgcctggggtgagctggccattctcacagtgatgtcttat
gaccgctatgtggccatctgcctcccattgcactatgaggtcatcatgagtcccagaaag
tgcacttgggctgtggcaactgtgtggctaagtggaggtatctcaggaacattgtacata
acaggtacactctttatcagattctgtggggacaaaattattcaccagttcttctgtgat
gtcccccagttgctcaagctctcctgctctaatgaccaccttgtaataatggacatggtt
agtttcctgactgcagtttcctttgcctgtttcactgggattgtcatctcctatgtccac
atattctccacagttctcaggatgccctctgctgaaagcaggtctaaggtcttctctact
tgcctgccccatctttttgttgtctcattgtttctttctacaggcgcctttgcatatcta
aacctaacctcagactcttcaactgctttagagttcttgctctctatcttttacacagta
ctacctccaactctcaaccctgttatttatagtctgagaaatgagacgataaagaatgtt
gtaaggaagttactgttgagcacaaaattcactgttagaatcattttttcctgttgtttc
tga

DBGET integrated database retrieval system