KEGG   Mus musculus (mouse): 258123Help
Entry
258123            CDS       T01002                                 

Gene name
Olfr1474, MOR202-26P, MOR202-42
Definition
(RefSeq) olfactory receptor 1474
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 258123
NCBI-ProteinID: NP_001011842
MGI: 3031308
Ensembl: ENSMUSG00000096273
Vega: OTTMUSG00000059511
UniProt: Q7TQQ8
Position
19; 19 A
AA seq 314 aa AA seqDB search
MENISEVTEFILVGLTDAPELQIPLFIIFTLIYLIALFGNLGMIILILLDSRLHTPMYFF
LCNLSVVDCVYASAITPKVIEGFLTGSKTISLNGCAAQMFFFVAFGAIESLILASMAYDR
HAAVCKPLHYTTIMTSTTCILIVTWCYTCGILQSSVHVALAFSLSFCHSNVINHFFCDIP
PLLDISCSDTHTNEITLLVLATLDLVFTLLVILNTYLLIFIAILRMRSAEAQRKAFSTCA
SHLITVSIFFGSLIFMYLQPSSNHSMDTDKIASVFYTMVIPMLNPVVYSLRNKEVKNAFK
KVVERLMSSFHLVH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagaatatttcagaggttactgaatttattcttgtaggcttgacagatgccccagag
cttcagattcctttgtttattatcttcactctcatttatttgattgcactgtttgggaat
cttgggatgatcatactgattctgctggactcccgactccacactcccatgtactttttc
ctctgtaatctctcggtggtggactgtgtttatgcctcagcaatcacccccaaggtgata
gaagggtttctcacaggaagtaagaccatatcattaaatgggtgtgctgcccagatgttc
ttctttgtagcctttggtgctattgaaagtttgatccttgcctcaatggcctatgaccgt
catgcagcagtgtgcaaacccctgcactatactaccattatgacaagtaccacctgcatt
ctaattgtcacttggtgctacacttgtgggatcttacaatcttctgtccatgttgctctg
gcattttctctttccttctgtcattccaacgtaattaatcactttttctgtgacattccc
ccactgctagacatttcttgttctgacacccacacaaatgagattacactgctcgtcttg
gctacattagatcttgttttcactctcttggttatcttaaacacttacctgcttattttc
attgctatcctgaggatgcgttcagctgaagcacagaggaaggccttctctacctgtgca
tctcatctcatcactgtgtctatcttctttggttcccttatattcatgtacttacagccc
agttccaatcattccatggacacagacaaaattgcatctgtgttttatacaatggtcatt
cctatgctgaaccctgtggtctacagcctgaggaacaaagaggtaaaaaatgcatttaag
aaagttgttgaaagattaatgtcttcatttcatttagtccattaa

DBGET integrated database retrieval system