KEGG   Mus musculus (mouse): 258148Help
Entry
258148            CDS       T01002                                 

Gene name
Olfr789, MOR111-13, MOR111-9P, Olfr789-ps1
Definition
(RefSeq) olfactory receptor 789
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258148 (Olfr789)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258148 (Olfr789)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258148 (Olfr789)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 258148
NCBI-ProteinID: NP_001292362
MGI: 3030623
Ensembl: ENSMUSG00000111273
Vega: OTTMUSG00000056570
UniProt: A0A1L1SV77
Position
10; 10 D3
AA seq 312 aa AA seqDB search
MENRTVPTEFILLGLSDDPGLQIVIFLFLILMYILSITGNLTIITLTLVDPHLQTPMYFF
LRNFSVLEITFTTVCIPRFLSTIVTRDKTISYNSCTAQLFFFIFLGITEFYLLTAMSYDR
YVAICKPLHYTTIMNRRVCILLVFSAWLAGFLNIFPPVILFLQLDYCGSNVIDHFACDYF
PLLQLSCSDTWLLEIIGFYSAIVILLFTLALIILSYMFIVKTILKLPSVSQRKKAFSTCS
SHMIVISISYGSCIFMYANPSAKEKASLTKGVAILNTSVAPMMNPFIYTLRNQQVKQAFK
DAIQKVVLFSGK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccgcacagtacccacagaattcattttattgggactgtcagatgaccctggg
cttcagattgtgatctttctctttttaattctcatgtacatactaagcatcactggaaac
ttgaccatcatcaccctcaccttggtagaccctcatctacaaacccccatgtatttcttc
ctcaggaacttctctgttttagaaataacctttacaactgtctgtatccctagattccta
agcacaattgttaccagggacaaaactatttcctacaatagttgcacagctcaattgttt
ttcttcatcttcttgggcatcactgaattttaccttctaacggctatgtcttatgatcgc
tatgtggccatctgcaaaccactgcactacacaaccatcatgaacagaagagtctgcata
ttgctggtcttttctgcctggctggcagggttcctaaacatcttcccacctgtcattctc
tttcttcagttagattactgcggctccaatgtcatcgatcacttcgcctgtgactacttc
cccctcctgcagttatcctgctcagacacatggctcctggaaattattgggttttattct
gcaatagtgatactgctcttcactttagcactgatcattctttcctacatgttcattgtc
aagacaatcttgaaacttccatctgtcagtcagaggaaaaaggctttctctacatgctcc
tcccacatgattgtcatttctatctcatatggtagctgtatattcatgtatgctaaccct
tctgccaaagaaaaagcatcactgaccaaaggagtagctattctcaatacttctgtggct
cctatgatgaatccatttatctacactctgaggaatcaacaagtgaagcaagcctttaag
gacgccatccaaaaagtagtgcttttctctggcaaatga

DBGET integrated database retrieval system