KEGG   Mus musculus (mouse): 258245Help
Entry
258245            CDS       T01002                                 

Gene name
Olfr1036, GA_x5J8B7TTB99-482-964, MOR245-25, MOR262-13
Definition
(RefSeq) olfactory receptor 1036
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258245 (Olfr1036)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258245 (Olfr1036)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258245 (Olfr1036)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 258245
NCBI-ProteinID: NP_997025
MGI: 3030870
Ensembl: ENSMUSG00000099820
Vega: OTTMUSG00000013625
UniProt: Q7TR85
Position
2; 2 D
AA seq 310 aa AA seqDB search
MPNFTDVTEFLLVGLTRRQELRVLFFVVFLVVYMVTLLGNIGMIILISISLQLQSPMYFF
LSHLSFVDVLFSSNVTPKMLENLLSESKTISYVGCLVQCYFFIALVLVEVFILAVMAFDR
YVAICNPLLYSSKMSRVVCIRLISVPYVYGFSVSLICTLWTYGLYFCGNVKINHFYCADP
PLIKIACGGVHIKEYTMIVIAGINFTYSLSVVLISYVLIVVAVLRMHSADGRRKAFSTCG
SHLTAVSMFYGTLIFMYLRRPTEESVEQGKMVAVFYTSVIPMLNPMIYSLRNKDVKEAVC
KIVAKANLRK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccaaattttacagatgtaaccgaattccttcttgttggattgacaaggcgtcaggaa
ctccgggttctcttttttgtggtgttcttggttgtttacatggtcactctgttgggcaac
attggtatgataattttgatcagcatcagcctgcagcttcagagtcctatgtattttttc
ctaagtcatttgtcctttgtggatgtgttgttctcctcaaatgttacccccaaaatgctg
gaaaacttattatcagaatcaaaaactatttcttatgttggatgcttggtacagtgctac
tttttcattgctctggtgctcgtggaggtttttattctggcagtgatggccttcgatcgc
tacgtggccatctgcaaccctttgttgtacagcagcaagatgtccagggttgtctgtatc
cgcctcatttctgtgccttatgtctatggattctctgtgagtctgatttgcactctgtgg
acatatggtttatatttctgtggaaacgttaaaatcaaccacttctattgtgctgatcct
cctctcatcaagattgcctgtggaggagtgcatatcaaagagtacacaatgattgtcatt
gctggcattaacttcacatattccttgtcagtggttctcatttcatatgtgctcattgta
gtagctgtgttacgcatgcactcggctgatggcaggagaaaggcattctccacctgtgga
tcccacttaacagctgtatccatgttttatggaaccctcatattcatgtatctgagaagg
ccaacggaggagtctgtggagcagggaaagatggttgctgtcttttataccagtgtgatt
cctatgctgaaccccatgatctacagtctcaggaacaaagatgtgaaagaagcagtctgc
aagatagttgccaaggcaaacttaaggaaatga

DBGET integrated database retrieval system