KEGG   Mus musculus (house mouse): 258248
Entry
258248            CDS       T01002                                 
Symbol
Or51a7, MOR8-5, Olfr576, Olfr576-ps1
Name
(RefSeq) olfactory receptor family 51 subfamily A member 7
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258248 (Or51a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258248 (Or51a7)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258248 (Or51a7)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258248
NCBI-ProteinID: NP_001001805
MGI: 3030410
Ensembl: ENSMUSG00000073962
Position
7:102614309..102615247
AA seq 312 aa
MSVFNNSEVMYFLLIGIPGLEYAHEWISIPIFLMYLIAIMGNCIIIFVIKTEPSLHEPMY
YFLTMLAVSDMGLSFSSLPTMLKIFFFNAMAISPNACFAQEFFIHGFTVMESSVLLIMSL
DRFLAIHNPLRYSSILNGRRVAKIGLILAFRSTVLVLPFPFTLRKLKYCHKNLLSHSYCL
HQDVMKLACSDNKINFIYGFFVALCTMLDFALILMSYVLILKTVLSIASLAERLKALNTC
VSHICAVLIFYVPIITLAAIHRFAKHKSPLLVILIADMFLLVPPLMNPIVYCIKTRQIRE
KVLGKLVNLCVR
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtctgttttcaacaactccgaggtcatgtattttcttctaattgggataccaggactg
gaatatgcccacgagtggatctccatccctatcttcctcatgtaccttattgccatcatg
ggtaactgcattatcatttttgtcatcaagacagaaccctctcttcacgagcccatgtac
tatttccttaccatgttggctgtctctgatatgggcttgtccttctcttctcttcctacc
atgcttaaaatcttctttttcaatgccatggcaatctcacccaatgcctgttttgcccaa
gagttctttatccatggcttcactgtcatggagtcctctgtgcttctgattatgtctttg
gaccgctttcttgccattcacaaccctttaagatacagttctatcctcaatggccgcaga
gttgctaaaatagggctaattttagccttcaggagcacagttttggtgcttccattccct
ttcacactaaggaaactgaaatactgtcacaagaatctcctctctcactcatactgcctt
catcaagatgtcatgaaactggcctgctctgataacaagatcaatttcatctatggcttc
tttgtggctctctgtaccatgctggactttgccttgattcttatgtcttatgtgctgatc
ttgaagacagttctcagtattgcatctctagcagaaaggcttaaggctctaaatacctgt
gtctcccacatctgtgctgtgctcatcttctatgtgcccatcatcaccctggctgccata
catcgctttgccaaacacaaaagtcccctacttgtaatccttattgcagatatgttcttg
ttggtgccacccctgatgaaccccattgtgtactgtataaagactcggcaaatccgggag
aaggtcttgggaaagttggttaacctatgtgtgagataa

DBGET integrated database retrieval system