KEGG   Mus musculus (mouse): 258252
Entry
258252            CDS       T01002                                 

Gene name
Olfr813, MOR108, MOR108-3
Definition
(RefSeq) olfactory receptor 813
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258252 (Olfr813)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258252 (Olfr813)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258252 (Olfr813)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258252
NCBI-ProteinID: NP_997030
MGI: 3030647
Ensembl: ENSMUSG00000052818
Vega: OTTMUSG00000056630
UniProt: Q7TRH5
Position
10; 10 D3
AA seq 310 aa
MRNRTSVTYFILLGLTDDPELEVVIFFFLFLTYLLSITGNLTIITLTLLDSHLKTPMYFF
LRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFFIFLGSTEFFLLASMSYDR
YVAICKPLHYTTIISNKICHQLIISSWLAGFLVIFPPLAMGLELDFCDSNIIDHFTCDSA
PLLQISCTDTSTLELMSFILALITLMTTLMLIILSYICILRTILKFPSAKQREKAFSTCS
SHMIVISISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFK
DLVRRKLASK
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaggaacagaacttcagtgacatacttcatcctcctgggtctgacagacgatcctgag
cttgaggttgtgattttcttttttctgtttctcacttacttgctgagcattaccggaaat
ttaaccatcattactctcacactgctggattcccacctgaagacacccatgtatttcttc
ctcaggaatttctccttcctagaaatctcatttacttctgtctgtaaccctaggtttttg
gtcagcatcttaactaaggacaaatcaatctcctataatgcatgtgttgcccaactattt
ttctttatcttccttggctcaacagagtttttccttctggcatccatgtcctatgatcgc
tatgtggctatttgcaagcctctgcactatacaaccatcatcagtaacaagatctgccac
cagctcatcatcagctcctggctggctggtttcttggtaatttttcctccactggccatg
ggtttagagctagatttctgtgactccaacattattgaccacttcacttgtgactctgct
cctttgctgcaaatatcctgcacagacacaagcaccttggagctcatgagctttatatta
gctttgatcacgcttatgaccaccctgatgctgataattctttcttacatatgcattctc
agaacaattctgaaatttccctcagccaaacaaagggaaaaggccttttcaacctgctcc
tcacatatgattgttatctccatatcctatggaagctgcatcttcatgtatgtgaaaaca
tctgccaaggctggagttgctttaacaaagggggtggctatgctcaacacctctgttgct
cccatgctgaatccttttatttacactttaaggaaccagcaggtgaaacaagcatttaag
gaccttgtaagaagaaaacttgcctcaaaatga

DBGET integrated database retrieval system