KEGG   Mus musculus (mouse): 258267Help
Entry
258267            CDS       T01002                                 

Gene name
Olfr370, MOR267-16, MOR26716
Definition
(RefSeq) olfactory receptor 370
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258267 (Olfr370)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258267 (Olfr370)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258267 (Olfr370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258267
NCBI-ProteinID: NP_666382
MGI: 3030204
Ensembl: ENSMUSG00000047286
Vega: OTTMUSG00000061135
UniProt: E9Q848
Position
8; 8 C2
AA seq 314 aa AA seqDB search
MECVNDTVVREFVFLGFSSLAELQLLLFAIFLSLYLFTLSTNAVIVSTIVLDRALHTPMY
FFLSVLSCSETCYTFVIVPKMLVDLLARKKSISFLGCAIQMFTFLFLGCSHSFLLAAMGY
DRYVAICHPLRYTVLMGHRVCVGLVAAACVCGFTVAQVITSLVFRLPFRSSNQLHHFFCD
ISPVLQLASHHPHSTQITIFLLCALVLVIPLFLILVSYIHIISTILQFPSTLGRYKAFST
CASHLIVVIVHYGCASFIYLRPKSSYSSSQDALISVSYTILTPLFNPVIYSLRNKDFKSA
LHRVIGRTVTLRQH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtgtaaatgacactgtggtcagagaatttgtcttccttggcttctcgtctctg
gctgagctgcagctgctactctttgccatcttcctgtccctctatttgttcactctgagc
accaacgctgtaattgtttccaccattgtgctagacagagcccttcatacgcccatgtac
ttcttcctttctgtcctgtcctgttctgagacctgctacaccttcgtcattgtgcccaag
atgctggttgacttgctggcgcggaagaagagcatctctttcctcggctgcgccatccaa
atgttcaccttcctcttcctcggctgttctcattccttcctgctggcagccatgggttat
gatcgatacgtggccatttgccaccctctgcgctacacggtgctcatggggcacagggta
tgcgtggggctagtagctgctgcgtgtgtctgtggcttcactgtggcacaggtaatcaca
tccctggtgtttcgtctacccttccgctcttccaatcaactccaccactttttctgtgac
atctcccctgttctccagttggcatctcaccaccctcactccactcagatcaccatcttc
ctgctttgcgcgctggtcttggttatccctctcttcttgatcctggtatcatatattcac
atcatttctaccatcctccaattcccttccacgctgggcaggtacaaagcgttttccacc
tgtgcctctcacctcattgttgtcatagtgcactatggatgtgcctcttttatctaccta
aggcccaagtccagctactcttccagccaggatgcgctgatatcagtatcctacactatc
ctaactccgttattcaatccagtcatctacagcttaagaaacaaagacttcaaatcagct
cttcatagggtaataggaagaacagttaccctaagacaacactga

DBGET integrated database retrieval system