KEGG   Mus musculus (mouse): 258271Help
Entry
258271            CDS       T01002                                 

Gene name
Olfr1311, MOR245-21
Definition
(RefSeq) olfactory receptor 1311
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258271 (Olfr1311)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258271 (Olfr1311)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258271 (Olfr1311)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 258271
NCBI-ProteinID: NP_666386
MGI: 3031145
Ensembl: ENSMUSG00000109403
Vega: OTTMUSG00000015119
UniProt: Q8VET0
Position
2; 2 E3
AA seq 312 aa AA seqDB search
MDKANHSVVSEFVFLGLSNRWGIQLLLFLFSSMFYIASVMGNLLIVFSVTADSNLHSPMY
FLLANLSFLDLGVCSIAAPKMIFDLFRKHKAISFGGCITQIFFIHAIGGTEMVLLIAMAF
DRYVAICKPLHYLTIMRPQICILILAVSWVLGLIHSVAQLAFVVDLPFCGPNILDSFYCD
LPQLIKLACTETSKLVFMVTANSGLISVGSFFILIISYIFILVTVRKHSSGSIAKALSTL
SAHVTVVVLFFGPLIFFYTWPFPSSHLDKFLAIFDAVLTPFLNPVIYTFRNKEMKAAMRK
LCSQLVNYRKVS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggataaagccaatcactctgttgtgtctgagtttgtgttcttgggactctccaataga
tggggaatccagttgcttctcttcctcttttcctccatgttctacatagcgagtgtgatg
ggaaacctcctcattgtgttctccgtgactgctgactccaacctgcattcccccatgtac
ttcctgctggccaatctctcatttcttgaccttggagtttgctctattgcagcacccaag
atgatttttgacctttttagaaagcacaaagccatctcatttggaggttgtataactcag
atcttctttattcatgctattgggggcacggaaatggtgcttctcatagccatggccttt
gataggtatgtagccatatgtaaacctcttcactacttgaccatcatgagaccacaaata
tgcattttaattttggcagtatcctgggtccttggacttattcactcagtggcccaacta
gcttttgttgtagacttgcccttctgcggacctaatatattggacagcttttactgtgat
cttcctcagcttattaaacttgcttgcacagagaccagtaaattggtgttcatggtcaca
gccaacagtggactcatctctgtgggctcctttttcatactcatcatttcttacatcttc
attttggtgactgttaggaaacactcttcaggcagcatagccaaggccctctctactttg
tcagctcatgtgactgtggtggttttgttctttggaccactaatcttcttctacacttgg
cccttcccttcatcacacttagacaaatttcttgccatttttgatgcagttctcacccct
tttctgaatccagtcatctacacattcaggaacaaggaaatgaaggcagcaatgaggaaa
ctctgctcccagcttgtgaattacaggaaggtctcctaa

DBGET integrated database retrieval system