KEGG   Mus musculus (mouse): 258284
Entry
258284            CDS       T01002                                 

Gene name
Olfr114, MOR218-, MOR218-10
Definition
(RefSeq) olfactory receptor 114
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258284 (Olfr114)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258284 (Olfr114)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258284 (Olfr114)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258284
NCBI-ProteinID: NP_666399
MGI: 2177497
Ensembl: ENSMUSG00000062629
Vega: OTTMUSG00000037463
UniProt: Q923Q8
Position
17; 17 B1
AA seq 312 aa
MIMENITTMSGFLLMGFSDNHELQILQAVLFLVTYLVGSAGNVIIITITTLDPQLQSPMY
YFLKQLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMLQIFFFTWFAWGEMAILTVMSY
DRYIAVCLPLHYEIIMCPRKCRWAVTAVWLSSSIPGTLYLATIFSIRICRAKIIHQFFCD
VPQLLKLSCSNDYLVIMGVADFLSVIGFACFVGIVISYVHIFSTVLRMPSAESRSKVFST
CLPHLFVVSLFLSTGIFAYLNPTSDFPTALEFLFSVFYTVLPPTLNPVIYSLRNDAIKSV
VRKLLLSRKFTS
NT seq 939 nt   +upstreamnt  +downstreamnt
atgataatggaaaatataaccacaatgagtggattcctcctcatgggattctctgacaac
catgagctgcagatcttacaggctgtgctcttcttggtgacatacctagtcggctcagca
gggaatgtcatcattatcaccatcacaacactggacccacagctccagtctccaatgtat
tactttctgaagcaactttccattctggacctctcatccctctctgtcacagtccctcag
tatgttgacagttccctggcacgaagtggctacatttcatatgggcagtgcatgctgcag
atatttttctttacatggtttgcctggggtgagatggccattctcacagtgatgtcatat
gatcgttatatagctgtttgccttcctctccactatgagatcatcatgtgtcccagaaag
tgtaggtgggctgtgacagctgtatggctaagcagcagtattccaggaaccctatatcta
gcaaccatattttctattagaatctgtagggccaaaataattcaccaattcttctgtgat
gtcccccagctgctcaagctctcctgctctaatgattaccttgtaataatgggagtggct
gacttcctgtcagtaataggttttgcctgcttcgttgggattgtcatctcctatgtccac
atattctccacagttctcaggatgccctctgctgaaagcaggtctaaggtcttctctact
tgcttgccgcacctgtttgttgtctcattgtttctttctacaggcatctttgcatatcta
aacccaacctcagactttccaactgctttagagttcttattttctgtcttttatacagta
ctacctccaactctcaaccctgttatttacagtttgagaaatgatgccataaagagtgtt
gtaaggaagttactgttgagtagaaaattcactagttag

DBGET integrated database retrieval system