KEGG   Mus musculus (mouse): 258295Help
Entry
258295            CDS       T01002                                 

Gene name
Olfr746, MOR106-12
Definition
(RefSeq) olfactory receptor 746
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258295 (Olfr746)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258295 (Olfr746)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258295 (Olfr746)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 258295
NCBI-ProteinID: NP_666410
MGI: 3030580
Ensembl: ENSMUSG00000058188
Vega: OTTMUSG00000058489
UniProt: E9Q840
Position
14; 14 C1
AA seq 314 aa AA seqDB search
MNVSEGSTVTYFVLLGFPGPWKIQIILFSLILLLYMITLTGNMAIICAVRWNQQLHTPMY
MFLANFSFLEIWYVTCTVPNMLVNSLSKTKTISFTGCFTQFYFFFSLGTTECFFLCAMAY
DRYLAICYPLHYPSIMTRQFCSILMSLCWIIGFSAHLIPIFFISQLSFCGPNIIDHFLCD
VDPLIALSCTPTHIIRHVFYSISTLIIILTGLYILGSYALELRAVLQVPSSDGRQKAFST
CGSHLLVVSLFYGTIMVMYVSPTSGNSVDMNKIITLIYSVVTPALNPFIYSLRNKDMKYA
LHHVFFGNSIMQNL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgtcagagggatccacggtgacatattttgtcttattgggattccctggtccc
tggaagattcaaatcatacttttctcactgattctgctgctctacatgataactttgact
gggaatatggccatcatttgtgcagtgagatggaaccaacaactccacacccctatgtat
atgttcctggccaacttctccttcctagaaatctggtacgtgacctgcacagttcccaac
atgctggtcaactctctttccaaaactaagactatatccttcactggatgctttactcag
ttctacttcttcttctccctgggcacaactgaatgcttcttcctctgtgccatggcttat
gatcggtacctagccatctgctacccactgcactatccttccatcatgactaggcaattc
tgcagtattctgatgtccctctgttggatcattggtttctctgcacatttgattcccatt
ttctttatttctcaattgtctttctgtggccccaatatcattgatcactttctctgtgat
gtggacccactaatagcactgtcctgtacccctacacacatcataaggcatgtattctat
tctataagtactcttatcattattctcactggtttgtacatccttggatcttatgccttg
gagctcagagctgttcttcaggttccttcttcagatggacgtcaaaaggccttctcaacc
tgtggatcccacctgctggtagtgtctctgttctatggaaccataatggtgatgtatgtc
agccccacatctggcaactcagttgacatgaataaaattatcacactgatatattctgtg
gtgacaccagctttaaatcctttcatctatagtctgcgtaacaaggatatgaaatatgct
ctccatcatgtcttctttgggaatagcattatgcaaaacttataa

DBGET integrated database retrieval system