KEGG   Mus musculus (mouse): 258302Help
Entry
258302            CDS       T01002                                 

Gene name
Olfr420, MOR105-10
Definition
(RefSeq) olfactory receptor 420
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258302 (Olfr420)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258302 (Olfr420)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258302
NCBI-ProteinID: NP_666417
MGI: 3030254
Ensembl: ENSMUSG00000055033
Vega: OTTMUSG00000050217
UniProt: E9Q4G0 A6H6I2
Position
1; 1 H3
AA seq 321 aa AA seqDB search
MGFSNWTTAQEFIFSAFPCSWGDSVICFIPLLFIYAFIIVGNLVIITVVQLNAHLHTPMY
FFISALSFLEIWYTTATIPKMLSSLLSERRSITLNGCVLQMYFFHSTGISEVCLLTAMAF
DRYLAICSPLHYPTIMTSRLCAQLTLGCCVCGFLTPLPEIAWISTLPFCGSNHLEHIFCD
FLPVLRLACTDTHTIVMIQVVDIVHAVEIITAVMLIFMSYVGIVAVILRIRSAEGRRKAF
STCVSHLTVFLLFFGSVALMYLRFSATYSLFWDTAIALAFAVLFPFFNPIIYSLRNKEIK
EAIKKHIGQAGILIGKSRNLP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggggttctccaattggaccactgctcaggagttcattttttctgctttcccttgctcc
tggggagattctgtcatctgcttcatcccactgctcttcatctatgctttcattatcgtt
gggaacctggttatcatcacagtggtccagctcaacgcacacctccacacacccatgtac
ttcttcatcagtgccctttccttcctggagatatggtacaccactgccaccatcccaaag
atgctctctagcctgcttagtgaacgaaggagtattacgttgaatggttgcgtcctgcag
atgtatttcttccattccacaggcatcagtgaggtttgtctcttgacagctatggccttt
gatcgatacctggctatctgcagccctcttcattatcctaccatcatgacttccagactg
tgtgcccagctgaccctcggttgctgtgtctgtggctttctcacacccctccctgagatt
gcctggatctccacacttcctttttgtggctctaatcaccttgagcatatcttctgtgac
ttcctcccggtgctgcgcctggcctgcacagatacccacaccatcgtcatgattcaggtg
gtagatattgtccatgctgtggagataattacggcagtgatgctcattttcatgtcctat
gttggtattgtggctgtgattctgcgcatccgttcagctgaaggccgccgtaaagcattt
tccacgtgcgtctcgcaccttactgtctttttgctcttctttggtagtgtggctctcatg
tatcttcgcttctctgctacctactccttgttctgggacactgccattgctctggccttt
gcagttctattccccttcttcaatcccatcatctacagccttaggaacaaagaaataaaa
gaagccataaaaaagcacataggtcaagctggcatcttaattggcaagagcagaaacctc
ccttaa

DBGET integrated database retrieval system