KEGG   Mus musculus (mouse): 258305Help
Entry
258305            CDS       T01002                                 

Gene name
Olfr1356, MOR142-1, MOR142-2_p
Definition
(RefSeq) olfactory receptor 1356
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258305 (Olfr1356)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258305 (Olfr1356)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258305 (Olfr1356)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 258305
NCBI-ProteinID: NP_666420
MGI: 3031190
Ensembl: ENSMUSG00000051190
Vega: OTTMUSG00000056724
UniProt: Q7TQU8
Position
10; 10 C1
AA seq 320 aa AA seqDB search
MERENQTGERNFLLLGFTEDSDLQSFFFGLLLSMYLVTITGNLLIIVAIISDPHLHMPMY
LFLSNLSIADIGFTSTTIPKVLQNIRTQSKFISFSGCITQIFFFIVFGCLDNLLLSVMAY
DRFVAICHPLHYVVIMNSCFCAMLALGSWIVSVMSSLPETLTVLRLSFCTNMEIPHFFCD
LPEVLKLACSDTLVNNIVTYSITIVIAGFPFSGILLSYSKIFSSILRIPSAGGKYKAFST
CGSHLLVVFLFYSNGLGVYLSSAATSSSRMSLVASLMYSIVTPMLNPFIYSLRNKDMQKA
LGKLLRKIMLLGEGTMVGLP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaccaaacaggagaaagaaactttctcctcctgggattcacagaagac
tctgacctgcagtccttcttctttgggttgcttctttctatgtacctggtcaccatcaca
ggcaacttgctcatcattgtggccatcatatctgacccccacctgcacatgcccatgtac
ttattcctctccaacctgtccatagctgacatcggcttcacctccaccactatccccaag
gttctgcagaatatccgcacacaaagcaaattcatctctttctcgggctgcatcacacag
atattttttttcattgtgtttggatgcctggacaatttactcctatcagtgatggcctat
gaccgctttgtggccatctgccatcccttgcactatgtggtcatcatgaattcttgcttc
tgtgcgatgctggctcttggatcatggatagtcagcgtcatgagttccctacctgagacc
ttgactgtgttaagactatccttctgtacaaacatggaaattccacactttttctgtgat
cttcccgaagtcctgaagcttgcctgttctgacacccttgttaataacattgtgacatat
tctataaccatagtcatagctggtttcccattctctgggattctattgtcttattctaag
attttctcctccatcctaagaattccttcagctgggggcaagtacaaagccttttctacc
tgtgggtctcatcttttggtggtcttcttattctatagcaatggtctaggggtctacctt
agctctgcagccacatcatcttctagaatgagtctagttgcctcactgatgtacagcata
gtcactcccatgctgaaccccttcatctacagcctgaggaacaaggacatgcagaaggcc
ttgggaaaactcctcaggaaaatcatgcttcttggtgaagggaccatggtaggacttcca
taa

DBGET integrated database retrieval system