KEGG   Mus musculus (mouse): 258310Help
Entry
258310            CDS       T01002                                 

Gene name
Olfr145, K21, MOR161-6
Definition
(RefSeq) olfactory receptor 145
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258310 (Olfr145)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258310 (Olfr145)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258310 (Olfr145)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258310
NCBI-ProteinID: NP_666425
MGI: 2177528
Ensembl: ENSMUSG00000066748
Vega: OTTMUSG00000061757
UniProt: Q60882 B2RQ58
Position
9; 9 A4
AA seq 310 aa AA seqDB search
MATENASVPEFILAGLTDQPGLRMPLFFLFLGFYMVTMVGNLGLITLIGLNSHLHTPMYF
FLFNLSLIDFCYSTVITPKMLVSFVSKKNIISYSGCMTQLFFFLFFVVSESFILSAMAYD
RYVAICNPLMYTVTMSPQVCLLLLLGVYVMGFAGAMAHTAFMVKLTFCADKLVNHYMCDI
LPLLERSCTSTYVNELVVFIVVGIDIGVPTVTIFISYALILSSILRISSTEGRSKAFSTC
SSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVAL
RKTLSRSSFS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaaatgcctctgtgccagagttcatcctcgcaggcctgacagaccagcca
ggactccgcatgcccctcttctttctgtttctaggtttctacatggtcaccatggtggga
aacctgggcttgatcaccctgattggactgaactctcacctgcacacccctatgtacttt
ttcctcttcaacttgtcccttatagatttctgctactccactgttattactcccaaaatg
ctggtgagctttgtctcaaagaaaaacatcatctcctactctggatgcatgacccagctc
ttcttttttcttttctttgttgtctctgagtccttcatcctatcagcaatggcatatgac
aggtatgttgccatctgtaatcctctgatgtacaccgtgaccatgtctccccaggtgtgc
ttactccttttgctaggtgtgtatgtgatgggatttgctggagccatggcccacacagca
ttcatggtgaaactgaccttctgtgctgacaagcttgtcaatcactacatgtgtgacatt
ctccctcttctggaacgctcttgcaccagcacctatgtaaatgagctggtagtcttcatt
gttgtgggcattgatataggggtacccacagtcaccatctttatttcttatgccctcatc
ctctccagtatccttcgcatcagttccacagagggcaggtccaaggccttcagcacctgc
agctcccacataattgcagtttctctcttttttggatcaggggcattcatgtatctcaaa
ccttcttcccttttgcctatgaaccaggggaaagtgtcgtccttgttttatacaattgtg
gtgcccatgctcaacccattaatctatagcttaaggaataaggatgtcaaagttgctctg
agaaaaacattgagcagaagttcattttcctaa

DBGET integrated database retrieval system