KEGG   Mus musculus (mouse): 258321
Entry
258321            CDS       T01002                                 

Gene name
Olfr809, MOR108, MOR108-4
Definition
(RefSeq) olfactory receptor 809
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258321 (Olfr809)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258321 (Olfr809)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258321 (Olfr809)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258321
NCBI-ProteinID: NP_666436
MGI: 3030643
Ensembl: ENSMUSG00000050251
Vega: OTTMUSG00000056626
UniProt: Q8VEX8
Position
10; 10 D3
AA seq 328 aa
MLILSVRFLVDKPSEMRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYLLSITGNLTIIT
LTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACAAQLFFFIFL
GSTEFFLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVVFPPLAMGLDLD
FCDSNTIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSYTCILRTILK
FPSAKQREKAFSTCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNP
FIYTLRNQQVKQAFKDLVRKKLASKLLI
NT seq 987 nt   +upstreamnt  +downstreamnt
atgttgattttatcagttagatttcttgtagacaaaccatcagagatgaggaacagaact
tcagtgacatacttcatcctcctgggtctgacagacgatcctgagcttcaggttgtgatt
ttcttttttctgtttctcacttacttgctgagcattactggaaatttaaccatcattact
ctcacactgttggattcccacctgaagacacccatgtatttcttcctcaggaatttctcc
ttcttagaaatctcatttacttctgtctgtaatcctaggtttttggtcagcatcttaact
aaggacaaatcgatctcctataatgcttgtgctgcccaactatttttctttatcttcctt
ggctcaacagagtttttccttctggcatccatgtcctatgatcgctatgtggctatttgc
aagcctctgcactatacgaccatcatcagtaacaagatctgccaccagctcatcatcagc
tcctggctggctggtttcttggtagtttttcctccactggccatgggcttagatctagat
ttctgtgactccaacactattgaccacttcacatgtgactctgctcctttgctgcaaata
tcctgcacagacacaagcaccttggagcttatgagctttatattagctttgatcacactt
atgaccacgctgatgctgataattctctcttacacctgtattctcagaactattctgaaa
tttccctcagccaaacaaagggaaaaggccttctcaacctgctcctcacacatgattgtt
gtctctatatcctatggaagctgcatcttcatgtatgtgaaaacatctgccaaggctgga
gttgctttaacaaagggggtggctatgctcaacacctctgttgctcccatgctgaatcct
tttatttacactttaaggaaccagcaggtgaaacaagcatttaaggatctcgtgcgaaaa
aaacttgcttcaaaactgctgatctga

DBGET integrated database retrieval system