KEGG   Mus musculus (house mouse): 258335
Entry
258335            CDS       T01002                                 
Symbol
Or1ab2, MOR130-1, Olfr374
Name
(RefSeq) olfactory receptor family 1 subfamily AB member 2
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258335 (Or1ab2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258335 (Or1ab2)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258335 (Or1ab2)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 258335
NCBI-ProteinID: NP_666450
MGI: 3030208
Ensembl: ENSMUSG00000046881
UniProt: Q7TRY0
Position
8:72860884..72864353
AA seq 313 aa
MEGANLSGVSEFLLLGLSQDPRQQQLLFSAFLSMYLLTGLGNLLIILAIAADPRLHTPMY
FFLANLAFVDVCFTSTTIPKMLANHVSGHKGISYSGCLTQMFFFIWFAGIDSFLLTAMAY
DRFVAICHPLHYTTSITPRLCGFLVTASWASAFANALTHTVLLTRLLFCGHNQVPHFFCD
LSPLLKLACSDTSLNDIMVYTVGALPIITPFVGILTSYTRIFTAVLRIPSTGGKWKAFST
CGSHLSVVSLFYGTLIGVYFSPTSSHTAQKDTAAAVMYTVVTPMMNPFIYTLRNKDMKGA
LMTFVRRTAVLVR
NT seq 942 nt   +upstreamnt  +downstreamnt
atggaaggagccaacctcagtggggtgtccgagttcttgctgctaggcttgtcacaggac
cccagacagcagcagctgctcttttctgccttcctgagcatgtaccttctcacaggccta
gggaacctgctcatcatcctggccattgctgctgatcccaggctgcacacccccatgtac
tttttcctggccaacctggcctttgtagatgtctgcttcacctccaccaccatccccaag
atgctggccaaccatgtgtcaggacacaaaggaatctcttactctggttgcctcacacag
atgttctttttcatctggtttgccggcattgacagcttcttgctgactgccatggcctat
gaccgctttgtggccatctgtcaccctctacattatacaacctcgatcacaccacggctg
tgtggcttcctggtcactgcatcctgggcctcagcctttgcaaatgccctgacccacaca
gtccttctgactcgcctcttgttctgtggccacaaccaggtcccccacttcttctgtgac
ctcagcccacttctgaagctggcctgttcagatacctctctcaatgacatcatggtatac
actgtgggcgcattgcccatcatcaccccctttgtgggcatcttgacctcctacacacgc
atcttcacagcagtgttgaggatcccatctacaggagggaaatggaaagcattctccacc
tgtggctcccatctctccgtggtgtccctcttctatgggacactgattggggtgtacttc
agtcccacatcctcccacacagcccagaaggacacagcagctgcagtgatgtacactgtg
gtcacccccatgatgaaccccttcatctataccctgaggaacaaggacatgaaaggtgcc
ctgatgacctttgtccgaaggacggcagtccttgttaggtag

DBGET integrated database retrieval system