KEGG   Mus musculus (house mouse): 258357
Entry
258357            CDS       T01002                                 
Symbol
Or51t4, MOR14-9, Olfr574
Name
(RefSeq) olfactory receptor family 51 subfamily T member 4
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258357 (Or51t4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258357 (Or51t4)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258357 (Or51t4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258357
NCBI-ProteinID: NP_666472
MGI: 3030408
Ensembl: ENSMUSG00000045824
Position
7:102597674..102598714
AA seq 346 aa
MFFRVCLQVTMLIFNNTTSPSSSSFLLTAFPGLELAHVWISIPVCGLYTIALLGNSIILF
VIIIERSLHKPMYYFLSMLSVVDLGLTITTLPTVLGVLWFHAREISIKVCLIQMFFVHGF
SFLESSVLVAMAFDRYLAICSPLKYATFLTDMMSFVIGLIICIRQVFFMFPSVMAVKSVS
FQGGQELSHPFCFHPDIIKYTYTNPWISSFWGMFLQLYLNGTDLLFILFSYVLILRTVLN
IVAPQKQQKALSTCVCHICAVTIFYVPMITLSVAHRLFSSTPRVICSILGNMYLLLPPVL
NPIIYSLKTKVIRQAIFQLFRFKDARGYSMRSLRGRWARRRQFSST
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtttttcagagtgtgtcttcaagtcaccatgctgatcttcaataataccacatccccc
tcctcctccagcttcctccttacggccttccctggattagaacttgctcacgtctggatc
tccattcctgtttgtggtctctacaccattgcactcttaggaaacagtattattttgttt
gtcattatcattgaacggagtctccacaagcccatgtactattttctctccatgctgtct
gttgttgatctaggtctgaccatcacaacccttcccacagtccttggtgtcctttggttt
catgcccgggagatcagcattaaagtatgcctcattcaaatgttctttgtgcatggcttc
tcattcctggagtcttcagtgttggtggccatggcttttgaccgctacttggccatctgc
agccctctgaagtatgctactttcctgacagacatgatgagctttgtgatcggactgatc
atctgtataagacaggtgtttttcatgtttccttcagttatggctgtgaagagtgtgtcc
ttccaaggaggccaagagctttcccatccattttgcttccatccagatataatcaaatac
acatacaccaacccctggatcagcagcttctggggaatgtttcttcagctctacctgaac
ggcactgacttattgttcattcttttctcctacgtcctgatccttcgcactgttctgaac
atcgtggctcctcaaaaacagcagaaagctcttagcacatgtgtttgtcacatctgtgct
gtgaccattttctatgtgccaatgatcaccctgtctgtggcacaccgtctcttcagttct
actcccagggtgatctgtagtattttgggcaatatgtatctgctcttgccgcctgtgctg
aatcctatcatttacagcttgaagaccaaggttattcgccaagccatattccagctgttc
cgattcaaggatgcaaggggctacagtatgaggagccttagaggaaggtgggctagaagg
agacaattttccagtacatga

DBGET integrated database retrieval system