KEGG   Mus musculus (mouse): 258374
Entry
258374            CDS       T01002                                 

Gene name
Olfr127, MOR218, MOR218-7
Definition
(RefSeq) olfactory receptor 127
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258374 (Olfr127)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258374 (Olfr127)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258374 (Olfr127)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 258374
NCBI-ProteinID: NP_666489
MGI: 2177510
Ensembl: ENSMUSG00000058114
Vega: OTTMUSG00000037339
UniProt: Q8VF25
Position
17; 17 B1
AA seq 323 aa
MTPRNMTTVSGFLLMGFSDNHELQILQALLFLVTYLLDSAGNFIIITITTIDKQLQSPMY
YFLKHLSIMDFSSLSVTVPQYVDSSLARSGYISYGQCMLQVFFFTGLAWSEVAILTVMSY
DRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGGISGTLFTASTLSIRFCGHKIIHQFFCD
IPQLLKLSCSNDDFGLLKVSTFIAVMGFACFVGIAFSYCQIFSTVLRMPSAEGRSKVFST
CLPHLFVVSFFLSTGICAYLKPTSDSPTALDLMLSIFYTVLPPTLNPVIYSLRNESLKRA
VKKLLLSEEFIGKNYVCSVFSAC
NT seq 972 nt   +upstreamnt  +downstreamnt
atgactccaagaaacatgacaacagtgagtggattcctcctcatggggttctctgacaac
catgagctgcagatcttacaggctttgctcttcttggtgacatacctattggattcagca
gggaacttcatcattatcaccatcacaacaatagacaaacagctccagtctccaatgtat
tactttctgaagcacctttccattatggacttctcatctctctctgtcacagttccccag
tatgttgacagttccctggcacgaagtggctatatttcatatgggcagtgcatgctgcag
gtttttttcttcacaggtttagcctggagtgaggtggccattctcacagtgatgtcttat
gaccgctatgtggccatctgcctcccactgcactatgaggtcataatgagtcccagaaag
tgcacttgggctgtggcagctgtgtggctaagtggaggtatctcaggaacattattcaca
gcaagtacactctctatcagattctgtgggcacaaaattattcaccagttcttctgtgat
atcccgcaattgctcaagctctcctgctctaatgatgactttggactactgaaagtgtct
actttcattgctgtaatgggatttgcctgctttgtggggattgccttctcctattgccag
atattctctacagttctcaggatgccctctgctgaaggccgatctaaggtcttctccacc
tgcctgccccatctcttcgttgtttcattttttctctcaacaggcatttgtgcctatcta
aagccaacctcagactcaccaactgctttagacctcatgctctctatcttttacacagta
ctacccccaaccctcaatcctgttatctatagtctaagaaatgagtccttgaaaagagct
gtaaagaagttacttttaagtgaagaattcattgggaaaaattatgtttgttctgttttt
agtgcctgctaa

DBGET integrated database retrieval system