KEGG   Mus musculus (mouse): 258397Help
Entry
258397            CDS       T01002                                 

Gene name
Olfr1303, MOR245-7, Olfr276, Olfr276-ps1
Definition
(RefSeq) olfactory receptor 1303
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258397 (Olfr1303)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258397 (Olfr1303)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258397 (Olfr1303)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 258397
NCBI-ProteinID: NP_666514
MGI: 3031137
Ensembl: ENSMUSG00000093804
Vega: OTTMUSG00000015086
UniProt: A2AVW1
Position
2; 2 E3
AA seq 312 aa AA seqDB search
MDGENHTVVSEFVFLGLTHSWEIQLLLLVLSSVLYILSMAGNILIVFSVTIDPHLHSPMY
FLLACLSFIDLVACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGVEMVLLVAMAF
DRYIAICKPLHYLTIMSPRVCVLFLGAAWGLGISHSLFQLAFLIDLPFCGPNILDSFYCD
LPKLLRLACKDTYKLQFMVTINSGFICVGSFLLLLISYIFILFSVWKHSSGGSSKALSTL
SAHITVVFLFFGPTLFIYTWPHPNSQIDKFLALFDAVLTPFLNPVIYTFRNKEMKVVIRR
VFKTLLTFRGIS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatggggagaaccacacagtggtgtctgagtttgtgtttctgggactcacccactcc
tgggagattcagctcctcctcctcgtgctctcctcggtgctctacatattaagcatggct
ggaaacatcctcattgtgttctctgtgaccattgaccctcacttacattcacctatgtac
ttcctactagcatgtctctccttcattgatttggtagcctgctctgttacttcccccaag
atggtttatgacttgtttagaaagcacaaagtcatctcctttggaggctgtatcactcag
atcttctttatccatttagttggtggagtggagatggtgctacttgtggccatggcattt
gacagatatatagccatatgtaagcccctgcactacctgaccatcatgagtccacgtgta
tgtgttttgtttctgggtgctgcttggggcctgggcattagccactcattgttccagctg
gcttttcttattgacttacccttctgtggcccaaatatactggacagcttttactgtgac
cttcctaaacttctcagattggcctgtaaagacacctacaagttgcagttcatggtcact
atcaacagtggtttcatctgtgttggctctttcttgttgcttcttatctcttacatcttc
atcttgtttagtgtctggaaacattcttcaggtggttcatccaaagccctctccactctt
tcagctcacatcacagtggtgtttctcttctttggtcctactctgtttatatatacgtgg
ccccatcctaactcccagatagacaaatttcttgctctttttgatgcggttcttactcct
tttctgaacccagttatctacacattcagaaataaagagatgaaggtagtaataaggaga
gttttcaaaacattattaacctttagaggtatttcataa

DBGET integrated database retrieval system