KEGG   Mus musculus (mouse): 258431Help
Entry
258431            CDS       T01002                                 

Gene name
Olfr937, MOR171-24
Definition
(RefSeq) olfactory receptor 937
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258431 (Olfr937)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258431 (Olfr937)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258431 (Olfr937)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 258431
NCBI-ProteinID: NP_666650
MGI: 3030771
Ensembl: ENSMUSG00000094182
Vega: OTTMUSG00000062258
UniProt: Q9EQB4
Position
9; 9 A5.1
AA seq 311 aa AA seqDB search
MATGNYCMLPEFILTGLSKKPQLQMPLFLLFLGIYVVTVVGNLGMITLIKLSSHLHTPMY
YFLSSLSFIDLCHSTVITPKMLVNFVIEKNIISYTGCMAQLYFFLIFAIAECHMLAAMAY
DRYVAICNPLLYNVTMSYQIYTSLIFGVYIIGVVCASAHTGFMIRIQFCNLEVINHYFCD
LLPLLELAHSSTYVNELLVLCFGTFNIVVPTMTILTSYIFIIANILRIRSTGGRSKAFST
CSSHILAVAVFFGSAAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVSVA
LKKILERKLFM
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaggaaactattgcatgttacctgagttcattctgactgggctctcaaagaag
ccacaactccagatgcctctcttcctcctcttcctaggaatctatgtggtcactgtagtg
gggaatttgggcatgattacactgattaagctcagttctcacctgcatacccccatgtac
tatttcctcagtagtttgtcctttattgatctctgccattccactgtcattacccccaaa
atgttggtgaactttgtgatagagaaaaacatcatttcctacactggatgcatggctcag
ctctatttctttctaatttttgctattgcagagtgtcatatgttagctgcaatggcatat
gatcgctatgttgccatctgtaaccccttgctttacaatgtaaccatgtcctatcagatt
tacacttccctgatctttggagtctatattattggtgtggtttgtgcatcagctcacaca
ggcttcatgatcagaatacagttttgtaacttagaggtgatcaaccactatttctgtgat
cttcttcccctgctggagcttgctcactctagtacttatgttaatgaattgttagtttta
tgttttggtacatttaacattgttgttccaaccatgactattcttacttcttacatcttc
atcattgccaacatcttacgcattcgttctactggaggcaggtccaaagccttcagtacc
tgcagctcccacatcttagctgttgctgtgttctttgggtctgctgcattcatgtacctt
caaccatcatcagtcagctccatggaccaagggaaagtgtcctctgtgttttataccatt
gttgttcccatgctgaaccccttgatctatagtctgaggaataaggatgtcagtgttgcc
ctgaagaaaatactagaaagaaaattattcatgtaa

DBGET integrated database retrieval system