KEGG   Mus musculus (mouse): 258458
Entry
258458            CDS       T01002                                 

Gene name
Olfr165, MOR279-1
Definition
(RefSeq) olfactory receptor 165
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258458 (Olfr165)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258458 (Olfr165)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258458 (Olfr165)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx T7SS_ESX1_EccB 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 258458
NCBI-ProteinID: NP_666677
MGI: 3029999
Ensembl: ENSMUSG00000050158
Vega: OTTMUSG00000058692
UniProt: Q8VFA2
Position
16; 16 A3
AA seq 313 aa
MMQWNNWTRNSDFILLGFFDHSPLHTFFFSLILAIFFMALIGNSVMVILIYLDAQLHTPM
YILLSQLSLMDLMLISTTVPQTAFNFLSGNKSISMAGCGVQIFFYVSLLGAECFLLAAMA
YDRYVAICYPLRYPILMSHKICSLMAAFSWILGSLDGIIDVAAVLSFSYCGTREIPHFFC
DIPALLTISCSDTLIFEKIIFFCCVIMLIFPVVIVIASYICVILAVIKMASAESRHKAFA
TCSSHVMVVVIYYGAAMFIYMQPSSSRSPNQDKLVSAFYTILTPLLNPLIYSLRNKEVAR
AFMKVLRMDKAAG
NT seq 942 nt   +upstreamnt  +downstreamnt
atgatgcaatggaacaactggaccaggaactctgatttcatcctactaggattttttgat
cacagtcctcttcatacttttttcttttctctcatcctggctatcttcttcatggccctc
ataggaaattctgtcatggtgattctcatctacctggatgcccaactccacacccccatg
tatatccttctcagccaactttctctcatggatctcatgctcatctctaccacagtaccc
caaacggccttcaacttcctttctggcaacaagtccatctccatggctggctgtggagtc
cagatatttttctatgtatctctacttggagctgagtgttttttattggctgcaatggcc
tatgaccgttatgtagctatttgttacccattaaggtaccctattctcatgagtcacaaa
atctgtagtctaatggctgccttctcttggattcttggctcccttgatggtataatcgat
gttgcagctgtactatctttttcatattgtggtaccagagaaatacctcactttttctgt
gatatccctgccctgctaactatttcatgtagtgataccttgatatttgaaaagattata
tttttctgctgtgtaattatgcttatcttccctgtagtcattgttattgcatcctatatc
tgtgtgattcttgctgtcattaaaatggcttcagctgagagtcgtcacaaagcttttgcc
acctgttcatctcacgtcatggtggtggtaatatactatggggcagccatgttcatatac
atgcagccctcttctagtcgttctcccaatcaagacaaactagtgtcagctttctacacc
attcttactccactgttgaaccccctaatttacagcctccgcaacaaagaagtagccagg
gcattcatgaaggtattaaggatggataaggcagcaggatga

DBGET integrated database retrieval system