KEGG   Mus musculus (mouse): 258466Help
Entry
258466            CDS       T01002                                 

Gene name
Olfr1261, MOR234-3
Definition
(RefSeq) olfactory receptor 1261
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258466 (Olfr1261)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258466 (Olfr1261)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258466 (Olfr1261)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 258466
NCBI-ProteinID: NP_666685
MGI: 3031095
Ensembl: ENSMUSG00000061295
UniProt: Q8VFB0
Position
2; 2 E1
AA seq 306 aa AA seqDB search
MSNVTEFILLGLTQDPDLQKFLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSY
LSVIDGFYSSSIAPKMIYDLISEKSTISFNGCMTQLFVEHFFAAAEIILLMSMAYDRYVA
ICKPLHYMTIMNRPLCVFLVGAAVILGFIHGGIQILFMAQLPFCGPNIIDHFMCDLIPLL
ELACTDTHTLGPLIAANSGSLCLLIFSMLVASYVVILRSLRNHSAEGRRKALSTCASHVT
VVVLFFVPCSYLYLRPMTSFPTDKAVTVFCTLVTPMLNPLIYTLRNEEVKRVMKKLWGRM
RKAGDM
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtcacagaatttatcctcctgggcctgacccaagacccagatctgcagaaa
ttcttattcattgtgtgcttaataatctatttgatcacactggctggtaacatgctcatc
tcagtcaccatcttcatcagcccagccctggccactcccatgtacttctttctttcctac
ttgtccgtcatagatggtttctactcttcttccatagcacccaaaatgatctatgaccta
atctctgagaagagcaccatatccttcaatggctgcatgactcagctttttgtggagcat
ttttttgctgcagctgaaatcatcttgctgatgtccatggcctatgatcgctatgtagcc
atctgcaagcccttgcactacatgaccatcatgaaccgacctctgtgtgtattcctggtg
ggggctgctgtaatcttaggattcatccatggagggatacagattttgtttatggcccag
ttaccattctgtggcccaaatatcattgatcactttatgtgtgatttaataccactcctg
gagttggcctgcactgacactcacactctgggacccctgatcgctgccaacagcgggtca
ctgtgtttactcattttctctatgctggttgcttcctatgtggtcatccttcgctccctg
agaaatcacagtgcagaagggcgtcgcaaagccctgtctacctgtgcctctcatgtcacc
gttgttgtcttattctttgttccttgttcatacctgtacctaaggcccatgacctccttc
cccactgacaaagctgtaactgtgttttgcaccctagtgacacctatgctgaaccctctg
atctataccctcagaaatgaggaagtcaaaagggttatgaagaagctctggggtcgaatg
aggaaagctggtgacatgtaa

DBGET integrated database retrieval system