KEGG   Mus musculus (mouse): 258508
Entry
258508            CDS       T01002                                 

Gene name
Olfr99, MOR156, MOR156-1
Definition
(RefSeq) olfactory receptor 99
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258508 (Olfr99)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258508 (Olfr99)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258508 (Olfr99)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 258508
NCBI-ProteinID: NP_666726
MGI: 2177482
Ensembl: ENSMUSG00000061972
Vega: OTTMUSG00000037414
UniProt: Q8VFE4
Position
17; 17 B1
AA seq 305 aa
MNCSQAPTLILLGLSSDAEKWQPLFSIFLVIYLLGLLGNLLLLLAIGTDVHLHTPMYFFL
SQLSFVDLCFITTTAPKMLEALWTGDGSISFSGCLTQLYFFAVFADMDNLLLAVMAIDRY
AAICHPLRYSALMTPFRCGVLVSGSWGVTNCVSLTHTLLLSKLYFHTNQEIPHFFCEFGP
LLLLSCSDTHLNKILVIILVGILGISAVLCIVSSYGCIFYAVAKVPSAQGKRKALSTCSS
HLSVVLLFYSTVFATYLKPPSSSRSSEEVVAAVMYSLVTPTLNPFIYSLRNKDVKSSLRR
ILNME
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaactgcagtcaggctcctacattaatcctcttgggactgtctagtgatgcagagaaa
tggcagcccctctttagcatcttccttgttatctacttgctgggtctcttagggaacctg
ctacttttgttagctattggcactgatgtccacctccacacccccatgtatttcttcctc
agtcagctctcatttgtggatctttgcttcatcaccaccacagcccctaaaatgctggag
gctctgtggactggagatggatcaatctcattctctggatgcctaactcagttgtacttc
tttgctgtttttgctgacatggataacctgcttctagcagtcatggctattgacaggtat
gccgctatctgtcatccactgcgctactcagctctcatgactccttttagatgtggggtt
ctagtcagtgggtcatggggagtaactaattgtgtgtctctgacccatactttgttgctc
tctaagttatatttccataccaatcaagagattcctcattttttctgtgaatttgggcct
ctcttattgctttcctgctcagatactcacctcaataaaatcctggtgataattttggtt
ggaattttaggaatcagtgcggttctctgcattgtaagttcttatggttgtattttttat
gctgtggctaaggttccatcagcacaggggaaaaggaaagcattgtccacgtgcagttcc
cacctctctgtagtcctccttttctacagcacagtctttgctacctacctgaagccccca
tctagttctcgttcctctgaggaggtggtagctgctgtcatgtattctctcgtaactccc
actctgaatcccttcatttatagtctgagaaataaggatgttaaaagttcattgaggaga
atcctaaacatggagtag

DBGET integrated database retrieval system