KEGG   Mus musculus (mouse): 258532Help
Entry
258532            CDS       T01002                                 

Gene name
Olfr373, MOR282-2
Definition
(RefSeq) olfactory receptor 373
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258532 (Olfr373)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258532 (Olfr373)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258532 (Olfr373)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 258532
NCBI-ProteinID: NP_666750
MGI: 3030207
Ensembl: ENSMUSG00000061561
Vega: OTTMUSG00000061131
UniProt: E9Q4J3
Position
8; 8 B3.3
AA seq 314 aa AA seqDB search
MGTSNVSSNSDFILMGLFSYTGPHLVLFFLMATVFIIGLLGNTTLLFLIATDSRLHTPMY
FLLSQLSLLDVGFPLVTIPKVVAEFLQGQNVISFGGCATQMFFLMLMGVSEGVLLSLMSY
DRYVAVCHPLHYQVLMRNQVCLVMVGASWFSGALVASILTSITLQFPYCASHTVDHFFCE
MPALLKLSCADTSAYELALSISGVLILLLPLSLIFISYGHVLGAVLLMRSAEARHKAFTT
CSSHVTVVGLFFGAAVFIYMVPGSYHSPKQDNVVSLFYSLITPTLNPLIYSLRNREVRMS
LVKFMGRSDFKVKG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggggacttcaaatgtgtcatcaaattcagatttcatcctcatggggctcttcagctac
acagggccccatcttgtcctgttcttcctcatggccaccgtgttcatcattggcctgcta
ggcaacaccaccctgctttttctgattgccacagactccaggctccacacacccatgtac
ttcctgctcagccaactctcacttctggatgtcggcttcccactggttaccatccccaaa
gtggtggctgagttcctgcaaggacagaatgtcataagctttgggggatgtgccactcag
atgttcttcctcatgctcatgggtgtctctgagggtgtccttctgtccctcatgtcttat
gaccgctacgtggccgtatgccaccccctgcactaccaggtgctcatgagaaaccaagtg
tgtctggtgatggtgggtgcatcctggttctcaggtgccttggtggcctccatcctgacc
tccatcaccctgcagttcccctactgtgcctcacacaccgtggaccacttcttctgtgag
atgccagctctcctcaagctgtcatgtgcagacacatcagcctatgagttggcgctctcc
atctctggggtgctgatcttactgctacccctgtctctcatcttcatttcctacggccac
gttctgggagctgtcctgctcatgcggtcagctgaagctagacacaaggctttcaccacg
tgctcctcacatgtgactgtagtgggtctcttttttggggcagctgtattcatatacatg
gtcccaggcagctaccacagcccaaaacaggataatgtggtatccctcttctacagcctc
atcacccctaccctcaaccccctcatctacagcttgagaaacagagaagttcgaatgtcc
ttggtcaagttcatgggcaggtctgacttcaaggtgaagggatga

DBGET integrated database retrieval system