KEGG   Mus musculus (mouse): 258543
Entry
258543            CDS       T01002                                 

Gene name
Olfr810, MOR113, MOR113-4
Definition
(RefSeq) olfactory receptor 810
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258543 (Olfr810)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258543 (Olfr810)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258543 (Olfr810)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258543
NCBI-ProteinID: NP_666761
MGI: 3030644
Ensembl: ENSMUSG00000069421
Vega: OTTMUSG00000056627
UniProt: Q8VFH9
Position
10; 10 D3
AA seq 312 aa
MKNHTRVTVFIIAGLTDDPQWKVVLFIFLLLTYLLSITGNLAIITLTLVDTHLKTPMYFF
LRNFSFLEFSYTTTCIPKLLVTMATGDKTISYGNCLTQVFFAFLFGASEFYLLAAMSYDR
YVAICKPLHYMTIMNNKVCVQLVLSCWLAGFFVIFPPLLLGLNLDFCASNIVDHFYCDTT
PLLQLSCTDTQLLETMGFVSALVTLLLTLVMVIVSYIYIAITILKIPSASQRKKAFSTCS
SHMIVISLSYGSCIFMYVKPSVKQRVSISKGISVLNTSVAPLLNPFIYTLRNQQVKKAFI
NTVHRIVSFSKK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaagaaccatacaagagtgacagttttcatcatagcaggtttgactgatgacccacag
tggaaagttgtgttattcatcttcctgcttcttacctatctgctcagcatcactggcaat
ctggccatcattacactcaccctggtggatactcacctgaagacacccatgtattttttc
cttcggaatttttccttcttagagttttcctacactactacatgcatccccaaattgctt
gttactatggcaacaggtgacaaaaccatttcctatggtaattgtttgactcaagtgttt
tttgctttcttatttggagcatcagaattttatttgctggcagccatgtcctatgacaga
tatgtagccatctgcaagcccctgcactatatgaccatcatgaacaataaagtctgtgtg
cagctggttctcagttgttggcttgctggcttttttgtcatctttccaccactgctgtta
ggcttgaatcttgacttctgtgcttccaacattgttgatcatttctactgtgacacaact
ccactcttgcagctttcctgcacagacacacagctcctggaaacaatgggatttgtctca
gctttggtaacactcttactcacactggtaatggtgatcgtatcctacatttacattgct
ataacaattctaaaaatcccttcagccagccagaggaagaaggctttctctacatgttct
tctcacatgattgtaatatccctttcatatggcagctgcatcttcatgtatgttaaacca
tcagtcaaacagagagtatctatttccaagggaatttctgtgctcaacacctcagtggct
ccacttctgaatccttttatctacaccttgaggaatcagcaagtgaaaaaggcattcatt
aatacagtacacaggattgtgtctttctcaaagaaatga

DBGET integrated database retrieval system