KEGG   Mus musculus (mouse): 258545Help
Entry
258545            CDS       T01002                                 

Gene name
Olfr811, MOR110-6
Definition
(RefSeq) olfactory receptor 811
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258545 (Olfr811)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258545 (Olfr811)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258545 (Olfr811)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF3810
Motif
Other DBs
NCBI-GeneID: 258545
NCBI-ProteinID: NP_666763
MGI: 3030645
Ensembl: ENSMUSG00000063173
Vega: OTTMUSG00000056628
UniProt: Q8VFI1
Position
10; 10 D3
AA seq 319 aa AA seqDB search
MKNQSLKIEFILLGLTDDPQLQIPIFLFLFFNYILSLMGNYMIIFLTLLDPHLKTPMYFF
LRNFSFLEIAFTTVCIPRFLISILSGDRTISYNACAAQLFFFFLLGSTEFYLLAAMSYDR
YVAICRPLHYPIIMNSKVCHQLVLSSWVTGFLVVFPGLLLGLKLDFCASKTIDHFLCDSS
PLLQLSCTDTHFIELLDFALAVMTLVITLILVILSYTLIIKTILKFPSAQQRRKAFSTCT
SHMVVVSITYGSCIFMYMKTSAKERVTLNKGVAVLNTSVAPLLNPFIYTLRNQQVKEAFK
HVLHRFCSLQNSETRFRHK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccaatcattgaagatagagtttattttgcttggtctgacagatgaccctcag
ctacaaattccaattttcctgtttctgtttttcaattacatcttgagcctcatggggaac
tacatgatcatcttcctcaccctactggatccccatcttaagactccaatgtatttcttt
ctccggaatttctctttcttagaaattgcattcaccacagtgtgcattcccaggtttctg
ataagcattctctcaggagacagaacaatttcctacaatgcttgtgcagctcaattattt
ttcttttttttactaggaagcacagagttttaccttctggctgccatgtcctatgatcgc
tatgtagccatctgtagaccactgcactaccccatcatcatgaatagcaaagtgtgccac
caactggtcctcagctcctgggtaactgggttcttagttgtatttccaggtttgctcttg
ggactcaaactagatttttgtgcctccaaaacaatagaccacttcctgtgtgacagttct
cctctcctgcaactgtcttgcacagacacccattttattgagttattggatttcgcttta
gctgttatgacacttgtgatcaccttgatcttagtgattctctcctatacactcatcatc
aaaaccattctaaagttcccttcagctcaacaacggagaaaggccttttccacctgtacc
tcccacatggttgttgtctccattacttatgggagttgtatcttcatgtacatgaaaaca
tcagccaaggagagggtgactttaaataaaggtgtagcagtgctcaacacttctgtggcc
cctttgctaaaccctttcatttacaccctaaggaatcagcaggtgaaggaagctttcaaa
catgtgcttcatagattttgctctctacaaaacagtgagacaaggtttagacataaataa

DBGET integrated database retrieval system