KEGG   Mus musculus (mouse): 258602Help
Entry
258602            CDS       T01002                                 

Gene name
Olfr150, M93, MOR171-18
Definition
(RefSeq) olfactory receptor 150
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258602 (Olfr150)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258602 (Olfr150)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258602 (Olfr150)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258602
NCBI-ProteinID: NP_666820
MGI: 2659178
Ensembl: ENSMUSG00000094353
Vega: OTTMUSG00000062390
UniProt: Q60895
Position
9; 9 A5.1
AA seq 312 aa AA seqDB search
MAYSNQSRVTEFIISGLTNKPELQLPLFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMY
FFLSSLSFIDLCYSTIITPKMLVNFVTTKNVISYQECMTQLYFFIAFVISECHMLAAMAY
DRYVAICNPLLYNVTMSYQVCSWMVGGVYGMGFIGAAIHTFCMLRVVFCKDNIINHYFCD
LFPLMELACSSTYVNEVVLLSLSAFNIFIPTLTILGSYIFIIISILRIKSTEGRFKAFST
CSSHFSAVSVFFGSLAFMYLQPFSVSSKDKGKVSSVFYTTIVPMLNPMIYSLRNRDVKLA
LNKLFQKKKFHV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatacagcaatcagtccagagtgactgagttcatcatctctgggttaaccaacaaa
ccagagctgcagctgcccctcttcctcctcttccttggaatctacctgttcacagtgctg
gggaacctgggcatgatcatcctgatcctgctcagctcgcacctgcacacccccatgtac
ttcttcctcagcagcctgtccttcattgacctctgctactccacaataatcacccctaaa
atgctggtgaactttgtgacaacaaaaaatgtcatctcctatcaggaatgtatgactcag
ctctatttcttcattgcttttgttatatctgagtgtcacatgttggctgcaatggcatat
gaccgctatgtcgccatttgtaatcccttgctttacaatgtcaccatgtcttaccaagtc
tgttcctggatggtaggtggggtatatggcatgggcttcattggtgcagcaattcatact
ttctgcatgctaagagtggttttctgtaaggataatataataaaccattacttctgtgat
cttttcccattgatggagcttgcctgctccagtacttatgtcaatgaggtagtactcctg
tctctcagtgctttcaatatctttattccaacattgactatcctgggttcttacatcttc
atcattattagtatcctccgtatcaaatccactgagggcagattcaaagccttcagcaca
tgtagctcccacttctctgccgtttctgtcttctttggttccctggcattcatgtatctg
cagcccttctctgtcagctccaaagacaaaggcaaagtgtcctctgtgttttacactact
attgtgcccatgctgaaccctatgatctacagcctgaggaatagggatgttaaacttgct
ctaaataagttatttcaaaaaaagaagtttcatgtataa

DBGET integrated database retrieval system