KEGG   Mus musculus (mouse): 258621Help
Entry
258621            CDS       T01002                                 

Gene name
Olfr344, MOR136-12
Definition
(RefSeq) olfactory receptor 344
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258621 (Olfr344)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258621 (Olfr344)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258621 (Olfr344)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258621
NCBI-ProteinID: NP_666839
MGI: 3030178
Ensembl: ENSMUSG00000096822
Vega: OTTMUSG00000012230
UniProt: Q8VFP9
Position
2; 2 B
AA seq 309 aa AA seqDB search
MRMDNKSTVSEFILLGLPIRPENQVIYSSLILTMYLTTVLGNLLIILLIRLDPHLHTPMY
FFLSHLALTDISFSSVTVPKMLVNMLTHSQSISYDGCVSQVYFFIVFGSIDSFLLTSMAY
DRYVAFCHPLHYTIIMNLSLCVLLVGMFWVLSSANALVQTLLLARLSHFRNNTIPYYFCD
LSTLLKLSSSDTTINDLIILVLGNAVITLPFICILVSYGYIGVTILKTPSIKGIRKALST
CGSHLCVVSLYYGSIIGLYCVPSSNNTSEKNAIVAVMYTVVTPMLNPFIYSLRNQDMKGA
LRNILSRTQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggataataagagcaccgtgtctgagttcatcctcctggggctccccattcga
ccagagaaccaagttatttactcttccctgattctgaccatgtacctgacaactgtgctg
gggaacctgctcatcatcctgctcatcaggctggaccctcacctccacacccccatgtac
ttctttctcagtcacttggccttaacagacatctctttctcatcagtcacagttccaaag
atgctggtgaatatgctgacacacagtcagtccatttcatatgatgggtgtgtttcccag
gtgtattttttcatagtttttggaagcattgatagctttcttctgacctccatggcatat
gacaggtatgtggccttctgtcatcctctgcattataccatcatcatgaatttgagcctc
tgtgttcttctagtaggaatgttctgggtcttatcttcagccaatgcccttgtgcaaacc
cttctcttggctcgcctatctcactttagaaacaacaccatcccctactatttctgtgac
ctctctactttgctgaagctgtccagctcagacaccaccatcaatgatcttatcatcctt
gttttaggtaatgcagtcattaccctgccattcatatgcattcttgtctcttatggctac
attggtgtcaccattctgaaaactccctccatcaagggaatccgcaaagccctgtccaca
tgtggctctcacctctgtgtggtatccttgtactatggatccatcattggactgtattgt
gtcccctcatctaataacaccagtgaaaaaaatgccattgtggctgttatgtacacagtt
gtcacacctatgctgaatccctttatttatagcctaaggaatcaggatatgaaaggagca
ctgagaaatatcctcagcagaacacaatga

DBGET integrated database retrieval system