KEGG   Mus musculus (mouse): 258628Help
Entry
258628            CDS       T01002                                 

Gene name
Olfr1489, MOR202-19
Definition
(RefSeq) olfactory receptor 1489
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258628 (Olfr1489)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258628 (Olfr1489)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258628 (Olfr1489)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258628
NCBI-ProteinID: NP_666846
MGI: 3031323
Ensembl: ENSMUSG00000045678
Vega: OTTMUSG00000059539
UniProt: Q8VFQ5
Position
19; 19 A
AA seq 313 aa AA seqDB search
MHNISEVTEFILVGLTDAPGLQVPLFIIFTFIYLTTLFGNLGMIVLILLDSSLHTPMYFF
LSNLSLVDCVYASAVTPKVIEGFLTEKKIISYNACATQMFFLIGFAIIEGFLLASMAYDR
HAAVCKPLYYSTSMTTTICTLLIVGSYISGLLQSSIHVAFTFHLSFCHSNVVNHFFCDIP
PLLALSCSSVYINEIVLFILAALNIALTILVIVNSYVLIFVAILRMRSTDGQKKAISTCA
SHLTTVSIFYGTIIFMYLQPSSTHSMDTDKVASVFYTMIIPMLNPLVYSLRNKEVKNAFK
KVTRKVLFSLGLV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcataatatttccgaagtcactgaatttatccttgtgggattaacagatgccccaggg
ctacaggtccctttatttatcatcttcacttttatttacttgaccacattgtttggtaac
cttgggatgattgtgttgattctcctggactctagtctccacactcccatgtactttttt
cttagtaacctctcactggtggattgtgtttatgcctcagctgtcactcccaaggtaata
gaagggtttctcacagaaaagaagatcatatcctacaatgcatgcgctacacagatgttc
ttcttaataggatttgcaattattgaaggttttctcttagcatcaatggcctatgatcgt
catgcagcagtgtgcaaacccttgtactactctacctccatgacaacaacaatatgtacc
ctgctcattgtgggttcttacatcagtggactcttacaatcttctatccatgttgccttc
actttccacctctccttttgccattccaatgtagtaaatcactttttttgtgacattccc
ccactactggctctttcttgctctagtgtttatataaatgaaattgtactgtttatcttg
gcagcactcaatatagctttaactatattggttatcgtgaactcttatgtacttattttt
gttgcaatcttgaggatgcgttctactgatggacaaaagaaggccatttccacctgtgca
tcccacctcaccactgtttcaatcttctatggcacaattatcttcatgtacttacagccc
agctccactcactccatggacactgacaaggtagcatctgtattctataccatgatcatt
cccatgcttaaccctcttgtctatagcctgaggaacaaagaagtcaagaatgcatttaaa
aaggttactagaaaagtgttgttttcactgggattagtctaa

DBGET integrated database retrieval system