KEGG   Mus musculus (mouse): 258640Help
Entry
258640            CDS       T01002                                 

Gene name
Olfr152, MOR181-1, Olfr4-1, V1
Definition
(RefSeq) olfactory receptor 152
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258640 (Olfr152)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258640 (Olfr152)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258640 (Olfr152)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 258640
NCBI-ProteinID: NP_666857
MGI: 1313139
Ensembl: ENSMUSG00000068816
Vega: OTTMUSG00000013836
UniProt: G3X9L8
Position
2 D; 2 49.95 cM
AA seq 316 aa AA seqDB search
MIMEFTSGNYTLVTEFILLGFPTRPELQIILFLVFLTLYGMILIGNIGLMLLIRMDPHLQ
TPMYFFLSNLSFVDLCYSSVIVPNMLVNFLSAKKSISYLGCALQFYFFCTFADTESFILA
AMAYDRYVAICNPLLYTVAMSRSLCIWLIVLSYVGGNMSSLVHTSFAFILKYCDKNIINH
FFCDLPPLLKLSCTDTSINEWLLSTYGSSVEIICFFIIIISYFFILLSVLKIRSTSGRKK
TFSTCASHLTSVAIYQGTLLFIYSRPSSLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKD
VKDAAKKALRSKIQSP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggaatttacaagtggaaactacaccttggtcaccgaatttatcctgttagga
tttccaacacggcctgaactccaaatcatcttgttccttgtgtttctgacgttatatggc
atgattttgatagggaatattggcttgatgttgttaattaggatggacccgcaccttcaa
actcctatgtactttttcctcagcaacctctcctttgtagacctttgttattcctcagtc
attgttcccaacatgcttgtcaatttcctctcagcaaagaaatctatctcttacctcggc
tgtgcactgcagttttatttcttctgcacatttgcagacactgaatcctttatcttggct
gctatggcctatgatcgctatgttgccatctgcaatcctttgttgtacacagttgcaatg
tccaggagcctctgcatatggttaattgtgctgtcatatgttggtggcaacatgagttct
ttggttcacacatcttttgcctttattctgaaatattgtgacaaaaatatcattaatcat
ttcttctgtgacctccctcctctgctgaagctttcctgtacggacacatccattaacgag
tggctactttccacttatgggagttctgtggagattatctgcttcttcatcatcatcatc
tcctactttttcatccttctctcagtcttgaagattcgctctacaagtgggagaaagaaa
accttctccacgtgtgcctctcacctgacctccgtggccatctatcagggcacacttctc
ttcatttattctcgtcccagctccctctactcccccaacactgataaaataatctcagtg
ttctacactattatcatcccagtgctaaacccattgatttacagtttgagaaataaagac
gtaaaagatgctgccaagaaagctctaaggtctaaaatacaatccccatga

DBGET integrated database retrieval system