KEGG   Mus musculus (mouse): 258657Help
Entry
258657            CDS       T01002                                 

Gene name
Olfr733, MOR241-2
Definition
(RefSeq) olfactory receptor 733
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258657 (Olfr733)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258657 (Olfr733)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258657 (Olfr733)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 258657
NCBI-ProteinID: NP_666874
MGI: 3030567
Ensembl: ENSMUSG00000090874
Vega: OTTMUSG00000058475
UniProt: Q14AK5
Position
14; 14 C1
AA seq 308 aa AA seqDB search
METENRTVVTEFIFTGLTESLDIQRLVFVLSLIFYIIILPGNVFIILTIISDPGLTAPLY
LFLGNLAFLDASYSFIVAPRMLIDIFSEKKIISYKACITQLFFLHFLGGGEFLLLVVMAF
DRYIAICRPLYYSTVMNPRVCYVMLLAPWLGGFIHSIIQVVLILRLPFCGPNHLDNFFCD
VPQVIKLACTDTFAVEILMIFNSGLLTLVCFLGLLTSYAVILCHVHRSASEGKNKAISTC
TTHVIIIFLMFGPAIFIYTRPFTALSADKVVSFFHTVIFPLLNPVIYTLRNQEVKTSMKK
LFIRQVIC
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagacagaaaacaggacagttgtcacagaattcatcttcacaggactgacagagtca
cttgacattcaacgcttggtctttgttctgagcttaattttctacatcatcattttgcct
ggaaatgtcttcatcatcctcaccatcatatcagaccctggacttactgcccctctttat
ttattcctgggaaatttggccttcctggatgcctcctactccttcattgtggctcctagg
atgttgatagacatcttctctgagaagaagataatctcctacaaagcctgcatcactcag
ctattttttttgcacttccttggaggaggggaatttttactactggttgtaatggccttt
gaccgctacattgccatctgcaggcctttgtattactccactgtcatgaatcccagagtc
tgctatgtgatgttgttggctccctggcttggaggatttattcactccattattcaggtt
gtcctcatcctccgcttgcccttctgtggtccaaatcatctagataatttcttctgtgat
gtcccacaggtcatcaagctagcctgtacagacacctttgcagtcgagatccttatgatc
ttcaatagtggcctgcttacccttgtgtgctttcttggtcttctgacttcctatgcagtt
attttatgccatgttcacaggtcagcttctgaaggaaaaaacaaagctatatctacatgt
accactcatgttatcattatatttcttatgtttggacctgcaatttttatttatacacgt
ccattcactgctctatcagctgacaaagtggtttctttcttccatacagtaatatttccc
ttattgaatcctgttatttatacccttcgaaaccaggaagtaaaaacttccatgaaaaag
ttatttattcgtcaagtaatttgttaa

DBGET integrated database retrieval system