KEGG   Mus musculus (mouse): 258670
Entry
258670            CDS       T01002                                 

Gene name
Olfr820, MOR116, MOR116-1
Definition
(RefSeq) olfactory receptor 820
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    258670 (Olfr820)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    258670 (Olfr820)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    258670 (Olfr820)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 258670
NCBI-ProteinID: NP_666886
MGI: 3030654
Ensembl: ENSMUSG00000048745
Vega: OTTMUSG00000056652
UniProt: Q8VFU5
Position
10; 10 D3
AA seq 312 aa
MANHSSVTKFILLGLTNDINLQAVLFLFLILTYILSVMGNSAIILLTLLDHRLQTPMYFF
LRNFAFLEISFTSVFVPKMLINIGTGDKTISFAGCFTQYFFAILLGATEFYLLAVMSYDR
YVAICRPLHYTTIMSRRLCFQLVLSSWLSGFIVVAVPHAMTLQLPFCASNIINHYCCDYT
ILLHLSCSDTHFIEVIQFLLAAVTLILTLLLVILSYTHIIKTILRIPSAQQRKKAFSTCS
SHMIVVSLSYGSCIFMYINPSFKDAANFNKRVAVLNTSVAPLLNPFIYTLRNKQVKIAFK
DMLSKTISFFKK
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcaaaccactcatcagtgacaaaattcattcttcttggattgacaaatgatatcaac
cttcaagctgtgctttttctctttctcatcttaacttatatcttaagtgtcatgggaaac
tcggccatcattctcttgactctgctggatcaccgcctccagacgcctatgtatttcttc
ctccgaaattttgcgtttttggagatatcttttacctctgtctttgttcccaagatgcta
atcaatattggaactggagacaagactatttcctttgctggttgcttcacacagtatttt
ttcgcaatccttctgggagcaaccgaattttacctcttagcagtgatgtcctatgaccgc
tatgttgccatttgcagacccctgcattacacaactatcatgagccggagactttgcttc
caactagttttaagttcctggttatctggttttatagttgttgctgtgccacatgcaatg
actcttcagttgcctttctgtgcatccaacatcatcaatcattattgctgtgactacact
atattgctgcatttatcatgttcagacacacacttcatagaagtgatccagttcctcctg
gctgctgtgaccctcatcctcaccttgctgttggtgattctctcctacacacacattatc
aagaccattttgaggatcccttctgctcaacagagaaaaaaggctttctctacatgttcc
tctcacatgatagtggtctcactctcttatggaagctgtattttcatgtatataaatcct
tcttttaaagatgcagcaaattttaataagagagtagctgttttaaatacctctgttgca
cctctgttaaacccattcatctacactcttagaaacaagcaagtaaaaatagccttcaaa
gatatgctaagcaagactataagtttctttaaaaagtaa

DBGET integrated database retrieval system